Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 polyclonal antibody. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PAX5 Polyclonal Antibody | anti-PAX5 antibody

PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5) APC

Gene Names
PAX5; BSAP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAX5; Polyclonal Antibody; PAX5 (Paired Box Protein Pax-5; B Cell-specific Transcription Factor; BSAP; PAX-5) APC; anti-PAX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PAX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PAX5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PAX5, aa1-391 (NP_057953.1).
Immunogen Sequence
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 polyclonal antibody. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 polyclonal antibody. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PAX5 antibody
May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene.
Product Categories/Family for anti-PAX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,149 Da
NCBI Official Full Name
paired box protein Pax-5
NCBI Official Synonym Full Names
paired box 5
NCBI Official Symbol
PAX5
NCBI Official Synonym Symbols
BSAP
NCBI Protein Information
paired box protein Pax-5; paired box homeotic gene 5; transcription factor PAX 5; B cell specific activator protein; B-cell lineage specific activator; B-cell-specific transcription factor
UniProt Protein Name
Paired box protein Pax-5
Protein Family
UniProt Gene Name
PAX5
UniProt Synonym Gene Names
BSAP
UniProt Entry Name
PAX5_HUMAN

NCBI Description

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PAX5: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. Interacts with DAXX. Binds DNA as a monomer. Binds TLE4.

Protein type: Oncoprotein

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of histone H3-K9 methylation; nervous system development; organ morphogenesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter; humoral immune response

Disease: Leukemia, Acute Lymphoblastic, Susceptibility To, 3

Research Articles on PAX5

Similar Products

Product Notes

The PAX5 pax5 (Catalog #AAA6388526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAX5 pax5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.