Rabbit anti-Human PAX5 Polyclonal Antibody | anti-PAX5 antibody

PAX5 (Paired Box Protein Pax-5, B Cell-specific Transcription Factor, BSAP, PAX-5) (FITC)

Cat. Num. AAA6388528

• Gene Names: PAX5; BSAP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAX5; Polyclonal Antibody; PAX5 (Paired Box Protein Pax-5; B Cell-specific Transcription Factor; BSAP; PAX-5) (FITC); anti-PAX5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PAX5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-PAX5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PAX5, aa1-391 (NP_057953.1).
• Immunogen Sequence: MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PAX5 expression in transfected 293T cell line by PAX5 polyclonal antibody. Lane 1: PAX5 transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PAX5 antibody

May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene.

Product Categories/Family for anti-PAX5 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 9951920
• NCBI GeneID: 5079
• NCBI Accession #: NP_057953.1
• NCBI GenBank Nucleotide #: NM_016734.1
• UniProt Accession #: Q02548; O75933; Q5SFM2; Q6S728; Q6S729; Q6S730; Q6S731; Q6S732; A3QVP6; A3QVP7; A3QVP8
• Molecular Weight: 42,149 Da
• NCBI Official Full Name: paired box protein Pax-5
• NCBI Official Synonym Full Names: paired box 5
• NCBI Official Symbol: PAX5
• NCBI Official Synonym Symbols: BSAP
• NCBI Protein Information: paired box protein Pax-5; paired box homeotic gene 5; transcription factor PAX 5; B cell specific activator protein; B-cell lineage specific activator; B-cell-specific transcription factor
• UniProt Protein Name: Paired box protein Pax-5
• Protein Family: Paired box protein
• UniProt Gene Name: PAX5
• UniProt Synonym Gene Names: BSAP
• UniProt Entry Name: PAX5_HUMAN

NCBI Description

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternatively spliced transcript variants encoding different isoforms have been described but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PAX5: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. Interacts with DAXX. Binds DNA as a monomer. Binds TLE4.

Protein type: Oncoprotein

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of histone H3-K9 methylation; nervous system development; organ morphogenesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of transcription from RNA polymerase II promoter; humoral immune response

Disease: Leukemia, Acute Lymphoblastic, Susceptibility To, 3