Mouse anti-Human PAPD7 Monoclonal Antibody

PAPD7 (POLS, DNA Polymerase sigma, DNA Polymerase kappa, LAK-1, PAP-associated Domain-containing Protein 7, Terminal Uridylyltransferase 5, TUTase 5, Topoisomerase-related Function Protein 4-1, TRF4-1, TRF4, TUTASE5)

Cat. Num. AAA645899

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PAPD7; Monoclonal Antibody; PAPD7 (POLS; DNA Polymerase sigma; DNA Polymerase kappa; LAK-1; PAP-associated Domain-containing Protein 7; Terminal Uridylyltransferase 5; TUTase 5; Topoisomerase-related Function Protein 4-1; TRF4-1; TRF4; TUTASE5); Anti -PAPD7 (POLS; anti-PAPD7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F8
• Specificity: Recognizes human POLS.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG

• Applicable Applications for anti-PAPD7 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa2-111 from human POLS (NP_008930) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Testing Data

(Detection limit for recombinant GST tagged POLS is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POLS monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-PAPD7 antibody

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. Alternatively spliced transcript variants that encode different isoforms have been described.

Product Categories/Family for anti-PAPD7 antibody

Antibodies; Abs to Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 449326076
• NCBI Official Full Name: PAPD7

NCBI Description

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jan 2010]

Uniprot Description

POLS: DNA polymerase, probably involved in DNA repair. May play a role in sister chromatid cohesion. Does not play a role in replication-dependent histone mRNA degradation. Belongs to the DNA polymerase type-B-like family.

Protein type: DNA repair, damage; EC 2.7.7.19; DNA replication; Transferase

Chromosomal Location of Human Ortholog: 5p15

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: polynucleotide adenylyltransferase activity; DNA binding; SMC protein binding; metal ion binding; DNA-directed DNA polymerase activity

Biological Process: response to drug; mitotic chromosome condensation; cell division; double-strand break repair; sister chromatid cohesion