Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human, Mouse PAK3 Monoclonal Antibody | anti-PAK3 antibody

PAK3 (Serine/Threonine-protein Kinase PAK 3, Beta-PAK, Oligophrenin-3, p21-activated Kinase 3, PAK-3, OPHN3) (FITC)

Gene Names
PAK3; ARA; bPAK; MRX30; MRX47; OPHN3; PAK-3; PAK3beta; beta-PAK
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAK3; Monoclonal Antibody; PAK3 (Serine/Threonine-protein Kinase PAK 3; Beta-PAK; Oligophrenin-3; p21-activated Kinase 3; PAK-3; OPHN3) (FITC); anti-PAK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H7
Specificity
Recognizes human PAK3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
544
Applicable Applications for anti-PAK3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human PAK3 (NP_002569) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(PAK3 monoclonal antibody. Western Blot analysis of PAK3 expression in NIH/3T3)

Western Blot (WB) (PAK3 monoclonal antibody. Western Blot analysis of PAK3 expression in NIH/3T3)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-PAK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein kinase PAK 3 isoform a
NCBI Official Synonym Full Names
p21 (RAC1) activated kinase 3
NCBI Official Symbol
PAK3
NCBI Official Synonym Symbols
ARA; bPAK; MRX30; MRX47; OPHN3; PAK-3; PAK3beta; beta-PAK
NCBI Protein Information
serine/threonine-protein kinase PAK 3
UniProt Protein Name
Serine/threonine-protein kinase PAK 3
UniProt Gene Name
PAK3
UniProt Synonym Gene Names
OPHN3; PAK-3
UniProt Entry Name
PAK3_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase and forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of a non-syndromic form of X-linked intellectual disability. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2017]

Uniprot Description

PAK3: a protein kinase of the STE20 family that regulates synapse formation and plasticity in the hippocampus. May be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Forms an activated complex with GTP-bound P21, CDC2 and RAC1 proteins. Missense and truncation mutations linked to nonsyndromic mental retardation type 30 (MRX30). Two alternatively spliced human isoforms have been reported.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Kinase, protein; Protein kinase, STE; STE group; STE20 family; PAKA subfamily

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: cytoplasm; plasma membrane; cytosol; endosome

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; Rho GTPase binding; metal ion binding; SH3 domain binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: axon guidance; activation of MAPK activity; MAPKKK cascade; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of actin filament polymerization; axonogenesis; positive regulation of neuron apoptosis; T cell costimulation; synapse organization and biogenesis; ephrin receptor signaling pathway; dendrite development; mitotic cell cycle; vascular endothelial growth factor receptor signaling pathway

Disease: Mental Retardation, X-linked 30

Research Articles on PAK3

Similar Products

Product Notes

The PAK3 pak3 (Catalog #AAA6148657) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAK3 (Serine/Threonine-protein Kinase PAK 3, Beta-PAK, Oligophrenin-3, p21-activated Kinase 3, PAK-3, OPHN3) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PAK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAK3 pak3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.