Mouse PAK3 Monoclonal Antibody | anti-PAK3 antibody

PAK3 (p21 Protein (Cdc42/Rac)-Activated Kinase 3, CDKN1A, MRX30, MRX47, OPHN3, PAK3beta, bPAK, hPAK3) (Biotin)

Cat. Num. AAA6172465

• Gene Names: PAK3; ARA; bPAK; MRX30; MRX47; OPHN3; PAK-3; PAK3beta; beta-PAK
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PAK3; Monoclonal Antibody; PAK3 (p21 Protein (Cdc42/Rac)-Activated Kinase 3; CDKN1A; MRX30; MRX47; OPHN3; PAK3beta; bPAK; hPAK3) (Biotin); p21 Protein (Cdc42/Rac)-Activated Kinase 3; hPAK3; anti-PAK3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A12
• Specificity: Recognizes PAK3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 544

• Applicable Applications for anti-PAK3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PAK3 (NP_002569, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAK3 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(PAK3 monoclonal antibody (M08), clone 3A12 Western Blot analysis of PAK3 expression in NIH/3T3 (Cat # L018V1).)

Related Product Information for anti-PAK3 antibody

PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, serve as targets for the small GTP binding proteins Cdc42 and RAC and have been implicated in a wide range of biological activities. The protein encoded by this gene forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1 proteins which then catalyzes a variety of targets. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of non-syndromic mental retardation X-linked type 30 (MRX30), also called X-linked mental retardation type 47 (MRX47). Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Product Categories/Family for anti-PAK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505601
• NCBI GeneID: 5063
• NCBI Accession #: NP_002569
• NCBI GenBank Nucleotide #: NP_002569.1
• UniProt Accession #: O75914
• NCBI Official Full Name: serine/threonine-protein kinase PAK 3 isoform a
• NCBI Official Synonym Full Names: p21 (RAC1) activated kinase 3
• NCBI Official Symbol: PAK3
• NCBI Official Synonym Symbols: ARA; bPAK; MRX30; MRX47; OPHN3; PAK-3; PAK3beta; beta-PAK
• NCBI Protein Information: serine/threonine-protein kinase PAK 3
• UniProt Protein Name: Serine/threonine-protein kinase PAK 3
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: PAK3
• UniProt Synonym Gene Names: OPHN3; PAK-3
• UniProt Entry Name: PAK3_HUMAN

NCBI Description

The protein encoded by this gene is a serine-threonine kinase and forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of a non-syndromic form of X-linked intellectual disability. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2017]

Uniprot Description

PAK3: a protein kinase of the STE20 family that regulates synapse formation and plasticity in the hippocampus. May be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Forms an activated complex with GTP-bound P21, CDC2 and RAC1 proteins. Missense and truncation mutations linked to nonsyndromic mental retardation type 30 (MRX30). Two alternatively spliced human isoforms have been reported.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Kinase, protein; Protein kinase, STE; STE group; STE20 family; PAKA subfamily

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: cytoplasm; plasma membrane; cytosol; endosome

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; Rho GTPase binding; metal ion binding; SH3 domain binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: axon guidance; activation of MAPK activity; MAPKKK cascade; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of actin filament polymerization; axonogenesis; positive regulation of neuron apoptosis; T cell costimulation; synapse organization and biogenesis; ephrin receptor signaling pathway; dendrite development; mitotic cell cycle; vascular endothelial growth factor receptor signaling pathway

Disease: Mental Retardation, X-linked 30