Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using BMF antibody at dilution of 1:200 (40x lens).)
Rabbit anti-Human BMF Polyclonal Antibody | anti-BMF antibody
BMF Polyclonal Antibody
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
BMF; Polyclonal Antibody; BMF Polyclonal Antibody; anti-BMF antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Sequence Length
184
Applicable Applications for anti-BMF antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human BMF
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using BMF antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human liver cancer using BMF antibody at dilution of 1:200 (40x lens).)
Related Product Information for anti-BMF antibody
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-BMF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14kDa/17kDa/20kDa
NCBI Official Full Name
bcl-2-modifying factor isoform bmf-1
NCBI Official Synonym Full Names
Bcl2 modifying factor
NCBI Official Symbol
BMF
NCBI Protein Information
bcl-2-modifying factor
UniProt Protein Name
Bcl-2-modifying factor
Protein Family
UniProt Gene Name
BMF
NCBI Description
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
May play a role in apoptosis. Isoform 1 seems to be the main initiator.
Research Articles on BMF
Similar Products
Product Notes
The BMF bmf (Catalog #AAA9133007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMF Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMF can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the BMF bmf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEPSQCVEEL EDDVFQPEDG EPVTQPGSLL SADLFAQSLL DCPLSRLQLF PLTHCCGPGL RPTSQEDKAT QTLSPASPSQ GVMLPCGVTE EPQRLFYGNA GYRLPLPASF PAVLPIGEQP PEGQWQHQAE VQIARKLQCI ADQFHRLHVQ QHQQNQNRVW WQILLFLHNL ALNGEENRNG AGPR. It is sometimes possible for the material contained within the vial of "BMF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
