Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Mouse anti-Human OSBPL8 Monoclonal Antibody | anti-OSBPL8 antibody

OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (Biotin)

Gene Names
OSBPL8; ORP8; MST120; OSBP10; MSTP120
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OSBPL8; Monoclonal Antibody; OSBPL8 (Oxysterol-binding Protein-related Protein 8; ORP-8; OSBP-related Protein 8; DKFZp686A11164; MGC126578; MGC133203; KIAA1451; ORP8; OSBP10) (Biotin); anti-OSBPL8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human OSBPL8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
889
Applicable Applications for anti-OSBPL8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(OSBPL8 monoclonal antibody. Western Blot analysis of OSBPL8 expression in Jurkat.)

Western Blot (WB) (OSBPL8 monoclonal antibody. Western Blot analysis of OSBPL8 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged OSBPL8 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OSBPL8 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-OSBPL8 antibody
ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux.
Product Categories/Family for anti-OSBPL8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
oxysterol-binding protein-related protein 8 isoform a
NCBI Official Synonym Full Names
oxysterol binding protein like 8
NCBI Official Symbol
OSBPL8
NCBI Official Synonym Symbols
ORP8; MST120; OSBP10; MSTP120
NCBI Protein Information
oxysterol-binding protein-related protein 8
UniProt Protein Name
Oxysterol-binding protein-related protein 8
UniProt Gene Name
OSBPL8
UniProt Synonym Gene Names
; ORP-8; OSBP-related protein 8

NCBI Description

This gene encodes a member of a family of proteins containing an N-terminal pleckstrin homology domain and a highly conserved C-terminal oxysterol-binding protein-like sterol-binding domain. It binds mutliple lipid-containing molecules, including phosphatidylserine, phosphatidylinositol 4-phosphate (PI4P) and oxysterol, and promotes their exchange between the endoplasmic reticulum and the plasma membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Lipid transporter involved in lipid countertransport between the endoplasmic reticulum and the plasma membrane: specifically exchanges phosphatidylserine with phosphatidylinositol 4-phosphate (PI4P), delivering phosphatidylserine to the plasma membrane in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum. Binds phosphatidylserine and PI4P in a mutually exclusive manner (PubMed:26206935). Binds oxysterol, 25-hydroxycholesterol and cholesterol (PubMed:17428193, PubMed:17991739, PubMed:21698267).

Research Articles on OSBPL8

Similar Products

Product Notes

The OSBPL8 osbpl8 (Catalog #AAA6143324) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSBPL8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSBPL8 osbpl8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSBPL8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.