Mouse anti-Human OSBPL8 Monoclonal Antibody | anti-OSBPL8 antibody

OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (AP)

Cat. Num. AAA6132718

• Gene Names: OSBPL8; ORP8; MST120; OSBP10; MSTP120
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OSBPL8; Monoclonal Antibody; OSBPL8 (Oxysterol-binding Protein-related Protein 8; ORP-8; OSBP-related Protein 8; DKFZp686A11164; MGC126578; MGC133203; KIAA1451; ORP8; OSBP10) (AP); anti-OSBPL8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes human OSBPL8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 889

• Applicable Applications for anti-OSBPL8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(OSBPL8 monoclonal antibody. Western Blot analysis of OSBPL8 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged OSBPL8 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-OSBPL8 antibody

ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux.

Product Categories/Family for anti-OSBPL8 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18079218
• NCBI GeneID: 114882
• NCBI Accession #: NP_065892.1
• NCBI GenBank Nucleotide #: NM_020841
• UniProt Accession #: Q9BZF1
• NCBI Official Full Name: oxysterol-binding protein-related protein 8 isoform a
• NCBI Official Synonym Full Names: oxysterol binding protein like 8
• NCBI Official Symbol: OSBPL8
• NCBI Official Synonym Symbols: ORP8; MST120; OSBP10; MSTP120
• NCBI Protein Information: oxysterol-binding protein-related protein 8
• UniProt Protein Name: Oxysterol-binding protein-related protein 8
• Protein Family: Oxysterol-binding protein-related protein
• UniProt Gene Name: OSBPL8
• UniProt Synonym Gene Names: ORP-8; OSBP-related protein 8

NCBI Description

This gene encodes a member of a family of proteins containing an N-terminal pleckstrin homology domain and a highly conserved C-terminal oxysterol-binding protein-like sterol-binding domain. It binds mutliple lipid-containing molecules, including phosphatidylserine, phosphatidylinositol 4-phosphate (PI4P) and oxysterol, and promotes their exchange between the endoplasmic reticulum and the plasma membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Lipid transporter involved in lipid countertransport between the endoplasmic reticulum and the plasma membrane: specifically exchanges phosphatidylserine with phosphatidylinositol 4-phosphate (PI4P), delivering phosphatidylserine to the plasma membrane in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum. Binds phosphatidylserine and PI4P in a mutually exclusive manner (PubMed:26206935). Binds oxysterol, 25-hydroxycholesterol and cholesterol (PubMed:17428193, PubMed:17991739, PubMed:21698267).