Mouse anti-Human NUDT21 Monoclonal Antibody | anti-NUDT21 antibody

NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X Motif 21, Nudix Motif 21,

Cat. Num. AAA648072

• Gene Names: NUDT21; atnudt21; nudix hydrolase homolog 21; NUDT21; T9L24.30; T9L24_30
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NUDT21; Monoclonal Antibody; NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5; Cleavage and Polyadenylation Specificity Factor 25kD Subunit; CPSF 25kD Subunit; Pre-mRNA Cleavage Factor Im 25kD Subunit; Nucleoside Diphosphate-linked Moiety X Motif 21; Nudix Motif 21; ; Anti -NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5; anti-NUDT21 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3F8
• Specificity: Recognizes human NUDT21.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

• Applicable Applications for anti-NUDT21 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length recombinant corresponding to aa1-228 from human NUDT21 (AAH01403) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.08kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NUDT21 on HeLa cell . [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NUDT21 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-NUDT21 antibody

CPSF5 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. CPSF5 is the 25kD subunit of the protein complex, which is composed of four polypeptides.

Product Categories/Family for anti-NUDT21 antibody

Antibodies; Abs to RNA Processing

NCBI and Uniprot Product Information

• NCBI GI #: 22330598
• NCBI GeneID: 843688
• NCBI Accession #: NP_177495.2
• NCBI GenBank Nucleotide #: NM_106012.5
• UniProt Accession #: Q8VY81; Q9FX46
• Molecular Weight: 22,636 Da
• NCBI Official Full Name: nudix hydrolase 21
• NCBI Official Symbol: NUDT21
• NCBI Official Synonym Symbols: atnudt21; nudix hydrolase homolog 21; NUDT21; T9L24.30; T9L24_30
• NCBI Protein Information: nudix hydrolase 21
• UniProt Protein Name: Nudix hydrolase 21, chloroplastic
• Protein Family: Nudix hydrolase
• UniProt Gene Name: NUDT21
• UniProt Synonym Gene Names: NUDX21; AtNUDT21
• UniProt Entry Name: NUD21_ARATH

Uniprot Description

Function: Probably mediates the hydrolysis of some nucleoside diphosphate derivatives

By similarity.

Cofactor: Magnesium or manganese

By similarity.

Subcellular location: Plastid › chloroplast

Potential.

Tissue specificity: Expressed in roots, leaves, stems and inflorescences. Ref.5

Disruption phenotype: No visible phenotype under normal growth conditions. Ref.5

Sequence similarities: Belongs to the Nudix hydrolase family.Contains 1 nudix hydrolase domain.

Sequence caution: The sequence AAG30977.1 differs from that shown. Reason: Erroneous initiation.