Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.08kD).)

Mouse anti-Human NUDT21 Monoclonal Antibody | anti-NUDT21 antibody

NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X Motif 21, Nudix Motif 21,

Gene Names
NUDT21; CPSF5; CFIM25
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUDT21; Monoclonal Antibody; NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5; Cleavage and Polyadenylation Specificity Factor 25kD Subunit; CPSF 25kD Subunit; Pre-mRNA Cleavage Factor Im 25kD Subunit; Nucleoside Diphosphate-linked Moiety X Motif 21; Nudix Motif 21; ; anti-NUDT21 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F8
Specificity
Recognizes human NUDT21.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NUDT21 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-228 from human NUDT21 (AAH01403) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.08kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NUDT21 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NUDT21 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NUDT21 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NUDT21 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-NUDT21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26,227 Da
NCBI Official Full Name
Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 21, mRNA
NCBI Official Synonym Full Names
nudix hydrolase 21
NCBI Official Symbol
NUDT21
NCBI Official Synonym Symbols
CPSF5; CFIM25
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 5
Protein Family

NCBI Description

The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]

Research Articles on NUDT21

Similar Products

Product Notes

The NUDT21 (Catalog #AAA6159193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NUDT21 (Cleavage and Polyadenylation Specificity Factor Subunit 5, Cleavage and Polyadenylation Specificity Factor 25kD Subunit, CPSF 25kD Subunit, Pre-mRNA Cleavage Factor Im 25kD Subunit, Nucleoside Diphosphate-linked Moiety X Motif 21, Nudix Motif 21, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT21 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUDT21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDT21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.