Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse NRXN1 Monoclonal Antibody | anti-NRXN1 antibody

NRXN1 (Neurexin 1, DKFZp313P2036, FLJ35941, Hs.22998, KIAA0578) (MaxLight 650)

Gene Names
NRXN1; PTHSL2; SCZD17; Hs.22998
Applications
Western Blot
Purity
Purified
Synonyms
NRXN1; Monoclonal Antibody; NRXN1 (Neurexin 1; DKFZp313P2036; FLJ35941; Hs.22998; KIAA0578) (MaxLight 650); Neurexin 1; KIAA0578; anti-NRXN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F7
Specificity
Recognizes NRXN1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
1477
Applicable Applications for anti-NRXN1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NRXN1 (NP_004792, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NRXN1 antibody
Neurexins function in the vertebrate nervous system as cell adhesion molecules and receptors. Two neurexin genes are among the largest known in human (NRXN1 and NRXN3). By using alternate promoters, splice sites and exons, predictions of hundreds or even thousands of distinct mRNAs have been made. Most transcripts use the upstream promoter and encode alpha-neurexin isoforms; fewer transcripts are produced from the downstream promoter and encode beta-neurexin isoforms. Alpha-neurexins contain epidermal growth factor-like (EGF-like) sequences and laminin G domains, and they interact with neurexophilins. Beta-neurexins lack EGF-like sequences and contain fewer laminin G domains than alpha-neurexins. The RefSeq Project has decided to create only a few representative transcript variants of the multitude that are possible. [provided by RefSeq]
Product Categories/Family for anti-NRXN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neurexin-1 isoform alpha1
NCBI Official Synonym Full Names
neurexin 1
NCBI Official Symbol
NRXN1
NCBI Official Synonym Symbols
PTHSL2; SCZD17; Hs.22998
NCBI Protein Information
neurexin-1
UniProt Protein Name
Neurexin-1
Protein Family
UniProt Gene Name
NRXN1
UniProt Synonym Gene Names
KIAA0578
UniProt Entry Name
NRX1A_HUMAN

NCBI Description

This gene encodes a single-pass type I membrane protein that belongs to the neurexin family. Neurexins are cell-surface receptors that bind neuroligins to form Ca(2+)-dependent neurexin/neuroligin complexes at synapses in the central nervous system. This complex is required for efficient neurotransmission and is involved in the formation of synaptic contacts. Three members of this gene family have been studied in detail and are estimated to generate over 3,000 variants through the use of two alternative promoters (alpha and beta) and extensive alternative splicing in each family member. Recently, a third promoter (gamma) was identified for this gene in the 3' region. Mutations in this gene are associated with Pitt-Hopkins-like syndrome-2 and may contribute to susceptibility to schizophrenia. [provided by RefSeq, Aug 2016]

Uniprot Description

NRXN1: Cell surface protein involved in cell-cell-interactions, excytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)- triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latroxin from spider venom. Belongs to the neurexin family. 4 isoforms of the human protein are produced by alternative promoter.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p16.3

Cellular Component: presynaptic membrane; cell surface; integral to plasma membrane; endocytic vesicle; integral to membrane; plasma membrane; cell junction

Molecular Function: protein binding; metal ion binding; calcium channel regulator activity; acetylcholine receptor binding; receptor activity; calcium ion binding; cell adhesion molecule binding; calcium-dependent protein binding; receptor binding

Biological Process: axon guidance; extracellular matrix organization and biogenesis; prepulse inhibition; neurotransmitter secretion; social behavior; vocal learning; learning; positive regulation of synaptic transmission, glutamatergic; cerebellar granule cell differentiation; negative regulation of filopodium formation; heterophilic cell adhesion; synaptic transmission; positive regulation of synaptogenesis; establishment of protein localization; synaptogenesis; adult behavior; calcium-dependent cell-cell adhesion; neuron adhesion; angiogenesis; neuromuscular process controlling balance

Disease: Pitt-hopkins-like Syndrome 2; Chromosome 2p16.3 Deletion Syndrome

Research Articles on NRXN1

Similar Products

Product Notes

The NRXN1 nrxn1 (Catalog #AAA6229037) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NRXN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NRXN1 nrxn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NRXN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.