Mouse anti-Human NRAS Monoclonal Antibody | anti-NRAS antibody

NRAS (GTPase NRas, Transforming Protein N-Ras, HRAS1) (Biotin)

Cat. Num. AAA6143260

• Gene Names: NRAS; NS6; CMNS; NCMS; ALPS4; N-ras; NRAS1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NRAS; Monoclonal Antibody; NRAS (GTPase NRas; Transforming Protein N-Ras; HRAS1) (Biotin); anti-NRAS antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 2A3
• Specificity: Recognizes human NRAS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1862

• Applicable Applications for anti-NRAS antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa90-189 from human NRAS (AAH05219) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged NRAS is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-NRAS antibody

This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated to a GTP-bound form by a GTPase activating protein and inactivated to a GDP-bound form by a guanine nucleotide-exchange factor. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML).

Product Categories/Family for anti-NRAS antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13528839
• NCBI GeneID: 4893
• NCBI Official Full Name: Homo sapiens neuroblastoma RAS viral (v-ras) oncogene homolog, mRNA
• NCBI Official Synonym Full Names: NRAS proto-oncogene, GTPase
• NCBI Official Symbol: NRAS
• NCBI Official Synonym Symbols: NS6; CMNS; NCMS; ALPS4; N-ras; NRAS1
• NCBI Protein Information: GTPase NRas
• Protein Family: GTPase

NCBI Description

This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. [provided by RefSeq, Jun 2011]