Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MESP1 monoclonal antibody (M09), clone 4B4 Western Blot analysis of MESP1 expression in COLO 320 HSR (Cat # L020V1).)

Mouse MESP1 Monoclonal Antibody | anti-MESP1 antibody

MESP1 (Mesoderm Posterior 1 Homolog (mouse), MGC10676, bHLHc5) (FITC)

Gene Names
MESP1; bHLHc5
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MESP1; Monoclonal Antibody; MESP1 (Mesoderm Posterior 1 Homolog (mouse); MGC10676; bHLHc5) (FITC); Mesoderm Posterior 1 Homolog (mouse); bHLHc5; anti-MESP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B4
Specificity
Recognizes MESP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MESP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MESP1 (NP_061140.1, 1aa-63aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MESP1 monoclonal antibody (M09), clone 4B4 Western Blot analysis of MESP1 expression in COLO 320 HSR (Cat # L020V1).)

Western Blot (WB) (MESP1 monoclonal antibody (M09), clone 4B4 Western Blot analysis of MESP1 expression in COLO 320 HSR (Cat # L020V1).)
Related Product Information for anti-MESP1 antibody
Mouse monoclonal antibody raised against a partial recombinant MESP1.
Product Categories/Family for anti-MESP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.5
NCBI Official Full Name
mesoderm posterior protein 1
NCBI Official Synonym Full Names
mesoderm posterior bHLH transcription factor 1
NCBI Official Symbol
MESP1
NCBI Official Synonym Symbols
bHLHc5
NCBI Protein Information
mesoderm posterior protein 1
UniProt Protein Name
Mesoderm posterior protein 1
UniProt Gene Name
MESP1
UniProt Synonym Gene Names
BHLHC5; bHLHc5

Uniprot Description

MESP1: Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.

Protein type: Cell development/differentiation; Transcription factor

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: nucleus

Molecular Function: transcription factor activity

Biological Process: cardiac muscle cell differentiation; endothelial cell differentiation; gastrulation; heart looping; lateral mesoderm development; negative regulation of endodermal cell fate specification; negative regulation of mesodermal cell fate specification; negative regulation of transcription, DNA-dependent; neurogenesis; positive regulation of Notch signaling pathway; positive regulation of striated muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent

Research Articles on MESP1

Similar Products

Product Notes

The MESP1 mesp1 (Catalog #AAA6176174) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MESP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MESP1 mesp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MESP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.