Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)

Mouse anti-Human, Mouse NR2E1 Monoclonal Antibody | anti-NR2E1 antibody

NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX) (HRP)

Gene Names
NR2E1; TLL; TLX; XTLL
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR2E1; Monoclonal Antibody; NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1; Nuclear Receptor TLX; Protein Tailless Homolog; Tll; hTll; TLX) (HRP); anti-NR2E1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes human NR2E1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NR2E1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa249-343 from human NR2E1 (NP_003260) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)

Western Blot (WB) (NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)
Related Product Information for anti-NR2E1 antibody
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity. May be involved in retinoic acic receptor (RAR) regulation in retinal cells.
Product Categories/Family for anti-NR2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group E member 1 isoform b
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group E member 1
NCBI Official Symbol
NR2E1
NCBI Official Synonym Symbols
TLL; TLX; XTLL
NCBI Protein Information
nuclear receptor subfamily 2 group E member 1
UniProt Protein Name
Nuclear receptor subfamily 2 group E member 1
UniProt Gene Name
NR2E1
UniProt Synonym Gene Names
TLX; Tll; hTll
UniProt Entry Name
NR2E1_HUMAN

NCBI Description

The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

Uniprot Description

NR2E1: Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half- site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity. May be involved in retinoic acic receptor (RAR) regulation in retinal cells. Belongs to the nuclear hormone receptor family. NR2 subfamily.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: nucleoplasm

Molecular Function: zinc ion binding; sequence-specific DNA binding; histone deacetylase binding; steroid hormone receptor activity

Biological Process: extracellular matrix organization and biogenesis; behavioral fear response; somatic stem cell maintenance; regulation of dendrite morphogenesis; regulation of timing of neuron differentiation; negative regulation of transcription from RNA polymerase II promoter; amygdala development; cerebral cortex neuron differentiation; visual perception; layer formation in the cerebral cortex; nervous system development; transcription initiation from RNA polymerase II promoter; dentate gyrus development; cell fate commitment; generation of neurons in the forebrain; olfactory bulb development; positive regulation of cell cycle; social behavior; negative regulation of neuron differentiation; positive regulation of angiogenesis; anterior commissure morphogenesis; retina development in camera-type eye; negative regulation of astrocyte differentiation; steroid hormone mediated signaling; gene expression; positive regulation of transcription from RNA polymerase II promoter; negative regulation of apoptosis

Research Articles on NR2E1

Similar Products

Product Notes

The NR2E1 nr2e1 (Catalog #AAA6153859) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NR2E1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR2E1 nr2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR2E1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.