Mouse anti-Human NME2 Monoclonal Antibody | anti-NME2 antibody

NME2 (Nucleoside Diphosphate Kinase B, NDK B, NDP Kinase B, nm23-H2, C-myc Purine-binding Transcription Factor PUF, NM23B) (HRP)

Cat. Num. AAA6153810

• Gene Names: NME2; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NME2; Monoclonal Antibody; NME2 (Nucleoside Diphosphate Kinase B; NDK B; NDP Kinase B; nm23-H2; C-myc Purine-binding Transcription Factor PUF; NM23B) (HRP); anti-NME2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B7-3F12
• Specificity: Recognizes human NME2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 686

• Applicable Applications for anti-NME2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-153 from human NME2 (AAH02476) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.46kD).)

Western Blot (WB)

(NME2 monoclonal antibody Western Blot analysis of NME2 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of NME2 expression in transfected 293T cell line by NME2 monoclonal antibody. Lane 1: NME2 transfected lysate (17.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NME2 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of NME2 over-expressed 293 cell line, cotransfected with NME2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NME2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-NME2 antibody

NM2 is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase. NME1 and NME2 comprise the 152 amino acid A and B polypeptide chains of the NM23 enzyme, respectively. NME2 is identical to the beta subunit of human erythrocyte NDP kinase. NDP kinases are involved in the synthesis of nucleoside triphosphates, and NM23 may act in the regulation of signal transduction by complexing with G proteins, causing activation/inactivation of developmental pathways. NEM2 has been identified as a putative tumor suppressor. High expression of mouse NME2 is detected in heart, liver, and kidney, with moderate expression in skeletal muscle, and negligible expression in other mouse tissues examined.

Product Categories/Family for anti-NME2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 37589033
• NCBI GeneID: 4831
• NCBI Official Full Name: Homo sapiens non-metastatic cells 2, protein (NM23B) expressed in, mRNA
• NCBI Official Synonym Full Names: NME/NM23 nucleoside diphosphate kinase 2
• NCBI Official Symbol: NME2
• NCBI Official Synonym Symbols: PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
• NCBI Protein Information: nucleoside diphosphate kinase B

NCBI Description

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010]