Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Liver)

Rabbit SIAH1 Polyclonal Antibody | anti-SIAH1 antibody

SIAH1 antibody - C-terminal region

Gene Names
SIAH1; SIAH1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SIAH1; Polyclonal Antibody; SIAH1 antibody - C-terminal region; anti-SIAH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Sequence Length
282
Applicable Applications for anti-SIAH1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Liver)

Immunohistochemistry (IHC) (Liver)

Western Blot (WB)

(Lanes:Lane1: 50 ug human HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-IgGSecondary Antibody Dilution:1:5000Gene Name:SIAH1Submitted by:Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaSIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (Lanes:Lane1: 50 ug human HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-IgGSecondary Antibody Dilution:1:5000Gene Name:SIAH1Submitted by:Peter Brand & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaSIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB)

(WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-SIAH1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-SIAH1 antibody
This is a rabbit polyclonal antibody against SIAH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase SIAH1 isoform a
NCBI Official Synonym Full Names
siah E3 ubiquitin protein ligase 1
NCBI Official Symbol
SIAH1
NCBI Official Synonym Symbols
SIAH1A
NCBI Protein Information
E3 ubiquitin-protein ligase SIAH1
UniProt Protein Name
E3 ubiquitin-protein ligase SIAH1
UniProt Gene Name
SIAH1
UniProt Synonym Gene Names
HUMSIAH; Siah-1
UniProt Entry Name
SIAH1_HUMAN

NCBI Description

This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SIAH1: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S- nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins. Homodimer. Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with DAB1, which may inhibit its activity. Interacts with UBE2E2. Interacts with PEG3. Interacts with GAPDH; leading to stabilize SIAH1. Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha- tubulin. Interacts with PEG10, which may inhibit its activity. Interacts with KHDRBS3. Interacts with SNCAIP and HIPK2. May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist. Widely expressed at a low level. Down- regulated in advanced hepatocellular carcinomas. Inhibited by interaction with SNCAIP (isoform 2, but not isoform 1). May be inhibited by interaction with PEG10. Belongs to the SINA (Seven in absentia) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ligase; Motility/polarity/chemotaxis; Apoptosis; EC 6.3.2.19; Cell development/differentiation; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 16q12.1

Cellular Component: early endosome; cytoplasm; plasma membrane; beta-catenin destruction complex; nucleus; cytosol

Molecular Function: protein C-terminus binding; protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; proteasomal ubiquitin-dependent protein catabolic process; nervous system development; axon guidance; anatomical structure morphogenesis; neuron apoptosis; protein destabilization; apoptosis; positive regulation of apoptosis; protein ubiquitination during ubiquitin-dependent protein catabolic process; spermatogenesis; protein catabolic process; cell cycle

Research Articles on SIAH1

Similar Products

Product Notes

The SIAH1 siah1 (Catalog #AAA3203963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIAH1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIAH1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SIAH1 siah1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVLEKQEKYD GHQQFFAIVQ LIGTRKQAEN FAYRLELNGH RRRLTWEATP. It is sometimes possible for the material contained within the vial of "SIAH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.