Mouse anti-Human Nkx 2.5 Monoclonal Antibody | anti-NKX2.5 antibody

Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (FITC)

Cat. Num. AAA6148499

• Gene Names: NKX2-5; CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Nkx 2.5; Monoclonal Antibody; Nkx 2.5 (Homeobox Protein Nkx-2.5; Cardiac-specific; CSX; NK-2 Homolog E; NKX2.5; NKX2E; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536) (FITC); anti-NKX2.5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E4-G5
• Specificity: Recognizes human NKX2-5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NKX2.5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-324 from human NKX2-5 (AAH25711) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (61.38kD).)

Western Blot (WB)

(NKX2-5 monoclonal antibody. Western Blot analysis of NKX2-5 expression in human thyroid (diffuse hyperplasia).)

Western Blot (WB)

(NKX2-5 monoclonal antibody, Western Blot analysis of NKX2-5 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody. Lane 1: NKX2-5 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NKX2-5 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-NKX2.5 antibody

NKX2.5 is a member of the NKX homeobox transcription factor family. NKX2.5 plays an essential role in heart development and is among the earliest factors expressed in cardiac lineage of developing embryos. Its targeted disruption in mice causes abnormal heart morphogenesis, severe growth retardation, and embryonic lethality around E9.5. Defects in NKX2.5 is associated with several forms of congenital heart diseases, such as atrial defect with atrioventricular conduction defects (ASD-AVCD) and tetralogy of Fallot (TOF). Transcription activation of NKX2.5 is also associated with certain B and T cell leukemias resultant from chromosomal translocation.

Product Categories/Family for anti-NKX2.5 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

References

1. Complex SUMO-1 Regulation of Cardiac Transcription Factor Nkx2-5. Costa MW, Lee S, Furtado MB, Xin L, Sparrow DB, Martinez CG, Dunwoodie SL, Kurtenbach E, Mohun T, Rosenthal N, Harvey RP.PLoS One. 2011;6(9):e24812. Epub 2011 Sep 12. 2. RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression. Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS.Nat Genet. 2008 Jan;40(1):61-8. Epub 2007 Dec 16.

NCBI and Uniprot Product Information

• NCBI GI #: 19343930
• NCBI GeneID: 1482
• Molecular Weight: 11,681 Da
• NCBI Official Full Name: Homo sapiens NK2 transcription factor related, locus 5 (Drosophila), mRNA
• NCBI Official Synonym Full Names: NK2 homeobox 5
• NCBI Official Symbol: NKX2-5
• NCBI Official Synonym Symbols: CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
• NCBI Protein Information: homeobox protein Nkx-2.5

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]