Rabbit anti-Human Nkx 2.5 Polyclonal Antibody | anti-NKX2.5 antibody

Nkx 2.5 (Homeobox Protein Nkx-2.5, Cardiac-specific, CSX, NK-2 Homolog E, NKX2.5, NKX2E, FLJ52202, FLJ97166, FLJ97195, FLJ97197, FLJ99536) (HRP)

Cat. Num. AAA6387077

• Gene Names: NKX2-5; CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Nkx 2.5; Polyclonal Antibody; Nkx 2.5 (Homeobox Protein Nkx-2.5; Cardiac-specific; CSX; NK-2 Homolog E; NKX2.5; NKX2E; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536) (HRP); anti-NKX2.5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NKX2-5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-NKX2.5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NKX2-5, aa1-324 (NP_004378.1).
• Immunogen Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 polyclonal antibody. Lane 1: NKX2-5 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NKX2.5 antibody

NKX2.5 is a member of the NKX homeobox transcription factor family. NKX2.5 plays an essential role in heart development and is among the earliest factors expressed in cardiac lineage of developing embryos. Its targeted disruption in mice causes abnormal heart morphogenesis, severe growth retardation, and embryonic lethality around E9.5. Defects in NKX2.5 is associated with several forms of congenital heart diseases, such as atrial defect with atrioventricular conduction defects (ASD-AVCD) and tetralogy of Fallot (TOF). Transcription activation of NKX2.5 is also associated with certain B and T cell leukemias resultant from chromosomal translocation.

Product Categories/Family for anti-NKX2.5 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4758090
• NCBI GeneID: 1482
• NCBI Accession #: NP_004378.1
• NCBI GenBank Nucleotide #: NM_004387.2
• UniProt Accession #: P52952; A8K3K0; B4DNB6; E9PBU6
• NCBI Official Full Name: homeobox protein Nkx-2.5 isoform 1
• NCBI Official Synonym Full Names: NK2 homeobox 5
• NCBI Official Symbol: NKX2-5
• NCBI Official Synonym Symbols: CSX; CSX1; VSD3; CHNG5; HLHS2; NKX2E; NKX2.5; NKX4-1
• NCBI Protein Information: homeobox protein Nkx-2.5; tinman paralog; homeobox protein CSX; cardiac-specific homeobox 1; homeobox protein NK-2 homolog E; NK2 transcription factor related, locus 5
• UniProt Protein Name: Homeobox protein Nkx-2.5
• UniProt Gene Name: NKX2-5
• UniProt Synonym Gene Names: CSX; NKX2.5; NKX2E
• UniProt Entry Name: NKX25_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

NKX2-5: Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4. Interacts with HIPK1 and HIPK2, but not HIPK3. Interacts with the C-terminal zinc finger of GATA4 through its homeobox domain. Also interacts with JARID2 which represses its ability to activate transcription of ANF. Interacts with FBLIM1. Expressed only in the heart. Belongs to the NK-2 homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus; transcription factor complex

Molecular Function: chromatin binding; DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; RNA polymerase II transcription factor activity, enhancer binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: adult heart development; atrial cardiac muscle cell development; BMP signaling pathway; cardiac muscle cell differentiation; cardiac muscle cell proliferation; cardiac muscle contraction; cardiac muscle morphogensis; cell differentiation; embryonic heart tube development; heart looping; heart morphogenesis; hemopoiesis; negative regulation of apoptosis; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; pharyngeal system development; positive regulation of cardioblast differentiation; positive regulation of cell proliferation; positive regulation of heart contraction; positive regulation of neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of cardiac muscle cell proliferation; sarcomere organization; spleen development; thyroid gland development; transcription from RNA polymerase II promoter; vasculogenesis; ventricular cardiac muscle cell development; ventricular cardiac myofibril development; Wnt receptor signaling pathway through beta-catenin

Disease: Atrial Septal Defect 7 With Or Without Atrioventricular Conduction Defects; Conotruncal Heart Malformations; Hypoplastic Left Heart Syndrome 2; Hypothyroidism, Congenital, Nongoitrous, 5; Tetralogy Of Fallot; Ventricular Septal Defect 3