Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NEIL2 Monoclonal Antibody | anti-NEIL2 antibody

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 405)

Gene Names
NEIL2; NEH2; NEI2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NEIL2; Monoclonal Antibody; NEIL2 (Endonuclease 8-like 2; DNA Glycosylase/AP Lyase Neil2; DNA-(apurinic or apyrimidinic site) Lyase Neil2; Endonuclease VIII-like 2; Nei Homolog 2; Nei-like Protein 2; FLJ31644; MGC2832; MGC4505; NEH2; NEI2) (MaxLight 405); anti-NEIL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B7
Specificity
Recognizes human NEIL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
2187
Applicable Applications for anti-NEIL2 antibody
FLISA, Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-333 from human NEIL2 (AAH13964) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-NEIL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens nei like 2 (E. coli), mRNA
NCBI Official Synonym Full Names
nei like DNA glycosylase 2
NCBI Official Symbol
NEIL2
NCBI Official Synonym Symbols
NEH2; NEI2
NCBI Protein Information
endonuclease 8-like 2
Protein Family

NCBI Description

This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017]

Research Articles on NEIL2

Similar Products

Product Notes

The NEIL2 (Catalog #AAA6191397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEIL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Sandwich FLISA: The detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NEIL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NEIL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.