Rabbit anti-Human NEIL2 Polyclonal Antibody | anti-NEIL2 antibody

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (AP)

Cat. Num. AAA6386820

• Gene Names: NEIL2; NEH2; NEI2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NEIL2; Polyclonal Antibody; NEIL2 (Endonuclease 8-like 2; DNA Glycosylase/AP Lyase Neil2; DNA-(apurinic or apyrimidinic site) Lyase Neil2; Endonuclease VIII-like 2; Nei Homolog 2; Nei-like Protein 2; FLJ31644; MGC2832; MGC4505; NEH2; NEI2) (AP); anti-NEIL2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NEIL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-NEIL2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NEIL2, aa1-332 (NP_659480.1).
• Immunogen Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 polyclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NEIL2 antibody

Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'-and 5'-phosphates.

Product Categories/Family for anti-NEIL2 antibody

Antibodies; Endonucleases

NCBI and Uniprot Product Information

• NCBI GI #: 209364524
• NCBI GeneID: 252969
• NCBI Accession #: NP_659480.1
• NCBI GenBank Nucleotide #: NM_145043.1
• Molecular Weight: 24,136 Da
• NCBI Official Full Name: Homo sapiens nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: nei endonuclease VIII-like 2 (E. coli)
• NCBI Official Symbol: NEIL2
• NCBI Official Synonym Symbols: NEH2; NEI2
• NCBI Protein Information: endonuclease 8-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; endonuclease VIII-like 2; nei homolog 2; nei like 2; nei-like protein 2
• Protein Family: Endonuclease

NCBI Description

NEIL2 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction (Bandaru et al., 2002 [PubMed 12509226])[supplied by OMIM, Mar 2008]