Mouse anti-Human NEIL2 Monoclonal Antibody | anti-NEIL2 antibody

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (Biotin)

Cat. Num. AAA6143140

• Gene Names: NEIL2; NEH2; NEI2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NEIL2; Monoclonal Antibody; NEIL2 (Endonuclease 8-like 2; DNA Glycosylase/AP Lyase Neil2; DNA-(apurinic or apyrimidinic site) Lyase Neil2; Endonuclease VIII-like 2; Nei Homolog 2; Nei-like Protein 2; FLJ31644; MGC2832; MGC4505; NEH2; NEI2) (Biotin); anti-NEIL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B7
• Specificity: Recognizes human NEIL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2187

• Applicable Applications for anti-NEIL2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-333 from human NEIL2 (AAH13964) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.63kD).)

Western Blot (WB)

(Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody. Lane 1: NEIL2 transfected lysate (36.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of NEIL2 over-expressed 293 cell line, cotransfected with NEIL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NEIL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-NEIL2 antibody

Antibodies; Endonucleases

NCBI and Uniprot Product Information

• NCBI GI #: 38196943
• NCBI GeneID: 252969
• NCBI Official Full Name: Homo sapiens nei like 2 (E. coli), mRNA
• NCBI Official Synonym Full Names: nei like DNA glycosylase 2
• NCBI Official Symbol: NEIL2
• NCBI Official Synonym Symbols: NEH2; NEI2
• NCBI Protein Information: endonuclease 8-like 2
• Protein Family: Endonuclease

NCBI Description

This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017]