Mouse anti-Human NDUFB7 Monoclonal Antibody | anti-NDUFB7 antibody

NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7, NADH-Ubiquinone Oxidoreductase B18 Subunit, Complex I-B18, CI-B18, Cell Adhesion Protein SQM1, MGC2480) (FITC)

Cat. Num. AAA6148431

• Gene Names: NDUFB7; B18; CI-B18
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFB7; Monoclonal Antibody; NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7; NADH-Ubiquinone Oxidoreductase B18 Subunit; Complex I-B18; CI-B18; Cell Adhesion Protein SQM1; MGC2480) (FITC); anti-NDUFB7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D4
• Specificity: Recognizes human NDUFB7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NDUFB7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa38-137 from human NDUFB7 (NP_004137) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(NDUFB7 monoclonal antibody Western Blot analysis of NDUFB7 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody. Lane 1: NDUFB7 transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NDUFB7 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFB7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-NDUFB7 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 10764847
• NCBI GeneID: 4713
• NCBI Accession #: NP_004137
• NCBI GenBank Nucleotide #: NM_004146
• UniProt Accession #: P17568
• Molecular Weight: 15kDa
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit B7
• NCBI Official Symbol: NDUFB7
• NCBI Official Synonym Symbols: B18; CI-B18
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
• Protein Family: NADH dehydrogenase
• UniProt Gene Name: NDUFB7
• UniProt Synonym Gene Names: CI-B18
• UniProt Entry Name: NDUB7_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFB7: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB7 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; Oxidoreductase; EC 1.6.5.3; Mitochondrial; EC 1.6.99.3

Chromosomal Location of Human Ortholog: 19p13.12

Cellular Component: mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial respiratory chain complex I; mitochondrion

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; mitochondrial respiratory chain complex I assembly