Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human NDUFB7 Monoclonal Antibody | anti-NDUFB7 antibody

NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7, NADH-Ubiquinone Oxidoreductase B18 Subunit, Complex I-B18, CI-B18, Cell Adhesion Protein SQM1, MGC2480)

Gene Names
NDUFB7; B18; CI-B18
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDUFB7; Monoclonal Antibody; NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7; NADH-Ubiquinone Oxidoreductase B18 Subunit; Complex I-B18; CI-B18; Cell Adhesion Protein SQM1; MGC2480); Anti -NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7; anti-NDUFB7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D4
Specificity
Recognizes human NDUFB7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Applicable Applications for anti-NDUFB7 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa38-137 from human NDUFB7 (NP_004137) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(NDUFB7 monoclonal antibody Western Blot analysis of NDUFB7 expression in A-431.)

Western Blot (WB) (NDUFB7 monoclonal antibody Western Blot analysis of NDUFB7 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody.|Lane 1: NDUFB7 transfected lysate (16.4kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFB7 expression in transfected 293T cell line by NDUFB7 monoclonal antibody.|Lane 1: NDUFB7 transfected lysate (16.4kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NDUFB7 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDUFB7 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFB7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of NDUFB7 over-expressed 293 cell line, cotransfected with NDUFB7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFB7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-NDUFB7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,402 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
NCBI Official Symbol
NDUFB7
NCBI Official Synonym Symbols
B18; CI-B18
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7; complex I-B18; complex I B18 subunit; cell adhesion protein SQM1; NADH-ubiquinone oxidoreductase B18 subunit
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Protein Family
UniProt Gene Name
NDUFB7
UniProt Synonym Gene Names
CI-B18
UniProt Entry Name
NDUB7_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFB7: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB7 subunit family.

Protein type: Oxidoreductase; Energy Metabolism - oxidative phosphorylation; EC 1.6.99.3; EC 1.6.5.3; Mitochondrial

Chromosomal Location of Human Ortholog: 19p13.12

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFB7

Similar Products

Product Notes

The NDUFB7 ndufb7 (Catalog #AAA6008101) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7, NADH-Ubiquinone Oxidoreductase B18 Subunit, Complex I-B18, CI-B18, Cell Adhesion Protein SQM1, MGC2480) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the NDUFB7 ndufb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EMVATQQEMM DAQLRLQLRD YCAHHLIRLL KCKRDSFPNF LACKQERHDW DYCEHRDYVM RMKEFERERR LLQRKKRREK KAAELAKGQG PGEVDPKVAL. It is sometimes possible for the material contained within the vial of "NDUFB7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.