Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M06), clone 3C1.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

Mouse NDN Monoclonal Antibody | anti-NDN antibody

NDN (Necdin Homolog (mouse), HsT16328, PWCR) (Biotin)

Gene Names
NDN; PWCR; HsT16328
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
NDN; Monoclonal Antibody; NDN (Necdin Homolog (mouse); HsT16328; PWCR) (Biotin); Necdin Homolog (mouse); PWCR; anti-NDN antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C1
Specificity
Recognizes NDN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NDN antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NDN (NP_002478, 222aa-321aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M06), clone 3C1.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M06), clone 3C1.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NDN transfected lysate using anti-NDN monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with NDN MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NDN transfected lysate using anti-NDN monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with NDN MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-NDN antibody
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq]
Product Categories/Family for anti-NDN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
necdin
NCBI Official Synonym Full Names
necdin, MAGE family member
NCBI Official Symbol
NDN
NCBI Official Synonym Symbols
PWCR; HsT16328
NCBI Protein Information
necdin
UniProt Protein Name
Necdin
Protein Family
UniProt Gene Name
NDN
UniProt Entry Name
NECD_HUMAN

NCBI Description

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]

Uniprot Description

NDN: Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle- promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 15q11.2-q12

Cellular Component: centrosome; cell projection; perikaryon; cytosol; nucleus

Molecular Function: gamma-tubulin binding; DNA binding

Biological Process: nervous system development; central nervous system development; transcription, DNA-dependent; nerve growth factor receptor signaling pathway; axon extension; neuron migration; axonal fasciculation; multicellular organismal homeostasis; glial cell migration; sensory perception of pain; post-embryonic development; respiratory system process; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; regulation of growth

Disease: Prader-willi Syndrome

Research Articles on NDN

Similar Products

Product Notes

The NDN ndn (Catalog #AAA6170488) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NDN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDN ndn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.