Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)

Mouse anti-Human NCKIPSD Monoclonal Antibody | anti-NCKIPSD antibody

NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3

Gene Names
NCKIPSD; DIP; DIP1; ORF1; WISH; VIP54; AF3P21; SPIN90; WASLBP
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NCKIPSD; Monoclonal Antibody; NCKIPSD (NCK Interacting Protein with SH3 Domain; AF3P21; 54kD VacA-interacting Protein; 54kD Vimentin-interacting Protein; VIP54; 90kD SH3 Protein Interacting with Nck; AF3p21; Dia-interacting Protein 1; DIP-1; Diaphanous Protein-interacting Protein; SH3; Anti -NCKIPSD (NCK Interacting Protein with SH3 Domain; anti-NCKIPSD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E4
Specificity
Recognizes human NCKIPSD.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH
Applicable Applications for anti-NCKIPSD antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa1-100 from human NCKIPSD (NP_909119) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NCKIPSD antibody
SPIN90 is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene.
Product Categories/Family for anti-NCKIPSD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,960 Da
NCBI Official Full Name
NCK-interacting protein with SH3 domain isoform 2
NCBI Official Synonym Full Names
NCK interacting protein with SH3 domain
NCBI Official Symbol
NCKIPSD
NCBI Official Synonym Symbols
DIP; DIP1; ORF1; WISH; VIP54; AF3P21; SPIN90; WASLBP
NCBI Protein Information
NCK-interacting protein with SH3 domain; dia interacting protein; dia-interacting protein 1; SH3 adapter protein SPIN90; 54 kDa VacA-interacting protein; 54 kDa vimentin-interacting protein; WASP-interacting SH3-domain protein; diaphanous protein interacting protein; 90 kDa SH3 protein interacting with Nck; SH3 protein interacting with Nck, 90 kDa; wiskott-Aldrich syndrome protein-interacting protein
UniProt Protein Name
NCK-interacting protein with SH3 domain
UniProt Gene Name
NCKIPSD
UniProt Synonym Gene Names
AF3P21; SPIN90; VIP54; DIP-1; WISH
UniProt Entry Name
SPN90_HUMAN

NCBI Description

The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

Function: Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo

By similarity. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42

By similarity. May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis. Ref.13

Subunit structure: Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain

By similarity. Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2. Ref.2 Ref.6 Ref.11 Ref.13

Subcellular location: Nucleus. Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

Tissue specificity: Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen. Ref.2

Involvement in disease: A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

Sequence similarities: Contains 1 SH3 domain.

Sequence caution: The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on NCKIPSD

Similar Products

Product Notes

The NCKIPSD nckipsd (Catalog #AAA646719) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCKIPSD can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the NCKIPSD nckipsd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP AYLRRLQGLE QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHH. It is sometimes possible for the material contained within the vial of "NCKIPSD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.