Mouse anti-Human NCKIPSD Monoclonal Antibody | anti-NCKIPSD antibody

NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3

Cat. Num. AAA646719

• Gene Names: NCKIPSD; DIP; DIP1; ORF1; WISH; VIP54; AF3P21; SPIN90; WASLBP
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NCKIPSD; Monoclonal Antibody; NCKIPSD (NCK Interacting Protein with SH3 Domain; AF3P21; 54kD VacA-interacting Protein; 54kD Vimentin-interacting Protein; VIP54; 90kD SH3 Protein Interacting with Nck; AF3p21; Dia-interacting Protein 1; DIP-1; Diaphanous Protein-interacting Protein; SH3; Anti -NCKIPSD (NCK Interacting Protein with SH3 Domain; anti-NCKIPSD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E4
• Specificity: Recognizes human NCKIPSD.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH

• Applicable Applications for anti-NCKIPSD antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa1-100 from human NCKIPSD (NP_909119) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-NCKIPSD antibody

SPIN90 is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene.

Product Categories/Family for anti-NCKIPSD antibody

Antibodies; Abs to Adapter Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 37577148
• NCBI GeneID: 51517
• NCBI Accession #: NP_909119.1
• NCBI GenBank Nucleotide #: NM_184231.2
• UniProt Accession #: Q9NZQ3; Q6GU34; Q6SPF3; Q8TC10; Q9UGM8; B4DFL5
• Molecular Weight: 78,960 Da
• NCBI Official Full Name: NCK-interacting protein with SH3 domain isoform 2
• NCBI Official Synonym Full Names: NCK interacting protein with SH3 domain
• NCBI Official Symbol: NCKIPSD
• NCBI Official Synonym Symbols: DIP; DIP1; ORF1; WISH; VIP54; AF3P21; SPIN90; WASLBP
• NCBI Protein Information: NCK-interacting protein with SH3 domain; dia interacting protein; dia-interacting protein 1; SH3 adapter protein SPIN90; 54 kDa VacA-interacting protein; 54 kDa vimentin-interacting protein; WASP-interacting SH3-domain protein; diaphanous protein interacting protein; 90 kDa SH3 protein interacting with Nck; SH3 protein interacting with Nck, 90 kDa; wiskott-Aldrich syndrome protein-interacting protein
• UniProt Protein Name: NCK-interacting protein with SH3 domain
• Protein Family: NCK-interacting protein with SH3 domain
• UniProt Gene Name: NCKIPSD
• UniProt Synonym Gene Names: AF3P21; SPIN90; VIP54; DIP-1; WISH
• UniProt Entry Name: SPN90_HUMAN

NCBI Description

The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

Function: Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo

By similarity. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42

By similarity. May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis. Ref.13

Subunit structure: Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain

By similarity. Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2. Ref.2 Ref.6 Ref.11 Ref.13

Subcellular location: Nucleus. Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

Tissue specificity: Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen. Ref.2

Involvement in disease: A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

Sequence similarities: Contains 1 SH3 domain.

Sequence caution: The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.