Testing Data
(Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)
Mouse anti-Human NCKIPSD Monoclonal Antibody | anti-NCKIPSD antibody
NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3
Gene Names
NCKIPSD; DIP; DIP1; ORF1; WISH; AF3P21; SPIN90; WASLBP; MGC23891
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCKIPSD; Monoclonal Antibody; NCKIPSD (NCK Interacting Protein with SH3 Domain; AF3P21; 54kD VacA-interacting Protein; 54kD Vimentin-interacting Protein; VIP54; 90kD SH3 Protein Interacting with Nck; AF3p21; Dia-interacting Protein 1; DIP-1; Diaphanous Protein-interacting Protein; SH3; anti-NCKIPSD antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E4
Specificity
Recognizes human NCKIPSD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NCKIPSD antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human NCKIPSD (NP_909119) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NCKIPSD is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NCKIPSD antibody
SPIN90 is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene.
Product Categories/Family for anti-NCKIPSD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
78,960 Da
NCBI Official Full Name
NCK-interacting protein with SH3 domain isoform 2
NCBI Official Synonym Full Names
NCK interacting protein with SH3 domain
NCBI Official Symbol
NCKIPSD
NCBI Official Synonym Symbols
DIP; DIP1; ORF1; WISH; AF3P21; SPIN90; WASLBP; MGC23891
NCBI Protein Information
NCK-interacting protein with SH3 domain; DIP-1; VIP54; OTTHUMP00000164823; OTTHUMP00000210186; dia interacting protein; dia-interacting protein 1; SH3 adapter protein SPIN90; 54 kDa VacA-interacting protein; 54 kDa vimentin-interacting protein; WASP-inter
UniProt Protein Name
NCK-interacting protein with SH3 domain
Protein Family
UniProt Gene Name
NCKIPSD
UniProt Synonym Gene Names
AF3P21; SPIN90; VIP54; DIP-1; WISH
UniProt Entry Name
SPN90_HUMAN
NCBI Description
The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]
Research Articles on NCKIPSD
Similar Products
Product Notes
The NCKIPSD nckipsd (Catalog #AAA6148409) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCKIPSD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCKIPSD nckipsd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCKIPSD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
