Mouse anti-Human NCBP2 Monoclonal Antibody | anti-NCBP2 antibody

NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (HRP)

Cat. Num. AAA6153710

• Gene Names: NCBP2; CBC2; NIP1; CBP20; PIG55
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCBP2; Monoclonal Antibody; NCBP2 (Nuclear Cap-binding Protein Subunit 2; 20kD Nuclear Cap-binding Protein; NCBP 20kD Subunit; CBP20; NCBP-interacting Protein 1; NIP1; Cell Proliferation-inducing Gene 55 Protein; PIG55) (HRP); anti-NCBP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A12
• Specificity: Recognizes human NCBP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NCBP2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from NCBP2 (NP_031388) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMR*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NCBP2 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-NCBP2 antibody

Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.

Product Categories/Family for anti-NCBP2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 19923387
• NCBI GeneID: 22916
• NCBI Accession #: NP_031388
• NCBI GenBank Nucleotide #: NM_007362
• UniProt Accession #: P52298; Q14924; Q2TS50; B2RE91; B4DMK7; E9PAR5
• Molecular Weight: 20.1 kDa (176aa), confirmed by MALDI-TOF
• NCBI Official Full Name: nuclear cap-binding protein subunit 2 isoform 1
• NCBI Official Synonym Full Names: nuclear cap binding protein subunit 2
• NCBI Official Symbol: NCBP2
• NCBI Official Synonym Symbols: CBC2; NIP1; CBP20; PIG55
• NCBI Protein Information: nuclear cap-binding protein subunit 2
• UniProt Protein Name: Nuclear cap-binding protein subunit 2
• Protein Family: Nuclear cap-binding protein
• UniProt Gene Name: NCBP2
• UniProt Synonym Gene Names: CBP20; CBP20; NIP1
• UniProt Entry Name: NCBP2_HUMAN

NCBI Description

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NCBP2: Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA- mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. Belongs to the RRM NCBP2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing; RNA-binding; Translation

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: nucleoplasm; mRNA cap complex; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; RNA binding; RNA 7-methylguanosine cap binding; nucleotide binding; RNA cap binding

Biological Process: transcription from RNA polymerase II promoter; spliceosomal snRNP biogenesis; viral reproduction; positive regulation of viral transcription; positive regulation of RNA export from nucleus; RNA splicing; histone mRNA metabolic process; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; mRNA capping; RNA elongation from RNA polymerase II promoter; mRNA catabolic process, nonsense-mediated decay; snRNA export from nucleus; gene expression; RNA-mediated gene silencing; nuclear mRNA cis splicing, via U2-type spliceosome; mRNA 3'-end processing; termination of RNA polymerase II transcription; regulation of translational initiation