Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human SENP5 Monoclonal Antibody | anti-SENP5 antibody

SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SENP5; Monoclonal Antibody; SENP5 (Sentrin-specific Protease 5; Sentrin/SUMO-specific Protease SENP5; SUMO1/sentrin Specific Peptidase 5; DKFZp564O1016; FKSG45; FLJ42398; MGC27076) (AP); anti-SENP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C2
Specificity
Recognizes human SENP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SENP5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa2-110 from human SENP5 (NP_689912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of SENP5 expression in transfected 293T cell line by SENP5 monoclonal antibody. Lane 1: SENP5 transfected lysate (86.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SENP5 expression in transfected 293T cell line by SENP5 monoclonal antibody. Lane 1: SENP5 transfected lysate (86.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SENP5 antibody
Covalent attachment of one protein to another is one of the more prominent posttranslational modifications in respect to size and ubiquity. Ubiquitin is the most familiar of the protein modifiers and its activation and transfer to target proteins has been studied extensively. Recently, a new group of ubiquitin-like proteins has been receiving a lot of attention. SUMO, or Sentrin, is one of the most intriguing. SUMO has been implicated in the stabilization of target proteins and/or their localization to sub-cellular complexes.
Product Categories/Family for anti-SENP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,310 Da
NCBI Official Full Name
sentrin-specific protease 5
NCBI Official Synonym Full Names
SUMO1/sentrin specific peptidase 5
NCBI Official Symbol
SENP5
NCBI Protein Information
sentrin-specific protease 5; SUMO1/sentrin specific protease 5; sentrin/SUMO-specific protease SENP5
UniProt Protein Name
Sentrin-specific protease 5
Protein Family
UniProt Gene Name
SENP5
UniProt Entry Name
SENP5_HUMAN

Uniprot Description

SENP5: Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO3 to its mature form and deconjugation of SUMO2 and SUMO3 from targeted proteins. Has weak proteolytic activity against full-length SUMO1 or SUMO1 conjugates. Required for cell division. Belongs to the peptidase C48 family.

Protein type: Nucleolus; EC 3.4.22.68; Protease

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleolus; nucleus

Molecular Function: protein binding; cysteine-type peptidase activity

Biological Process: cellular protein metabolic process; protein sumoylation; cell division; proteolysis; post-translational protein modification; cell cycle

Similar Products

Product Notes

The SENP5 senp5 (Catalog #AAA6133664) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SENP5 (Sentrin-specific Protease 5, Sentrin/SUMO-specific Protease SENP5, SUMO1/sentrin Specific Peptidase 5, DKFZp564O1016, FKSG45, FLJ42398, MGC27076) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SENP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SENP5 senp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SENP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.