Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged NCBP2 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human NCBP2 Monoclonal Antibody | anti-NCBP2 antibody

NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (FITC)

Gene Names
NCBP2; CBC2; NIP1; CBP20; PIG55
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCBP2; Monoclonal Antibody; NCBP2 (Nuclear Cap-binding Protein Subunit 2; 20kD Nuclear Cap-binding Protein; NCBP 20kD Subunit; CBP20; NCBP-interacting Protein 1; NIP1; Cell Proliferation-inducing Gene 55 Protein; PIG55) (FITC); anti-NCBP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A12
Specificity
Recognizes human NCBP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NCBP2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from NCBP2 (NP_031388) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMR*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NCBP2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NCBP2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-NCBP2 antibody
Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.
Product Categories/Family for anti-NCBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.1 kDa (176aa), confirmed by MALDI-TOF
NCBI Official Full Name
nuclear cap-binding protein subunit 2 isoform 1
NCBI Official Synonym Full Names
nuclear cap binding protein subunit 2
NCBI Official Symbol
NCBP2
NCBI Official Synonym Symbols
CBC2; NIP1; CBP20; PIG55
NCBI Protein Information
nuclear cap-binding protein subunit 2
UniProt Protein Name
Nuclear cap-binding protein subunit 2
UniProt Gene Name
NCBP2
UniProt Synonym Gene Names
CBP20; CBP20; NIP1
UniProt Entry Name
NCBP2_HUMAN

NCBI Description

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NCBP2: Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA- mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. Belongs to the RRM NCBP2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing; RNA-binding; Translation

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: nucleoplasm; mRNA cap complex; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; RNA binding; RNA 7-methylguanosine cap binding; nucleotide binding; RNA cap binding

Biological Process: transcription from RNA polymerase II promoter; spliceosomal snRNP biogenesis; viral reproduction; positive regulation of viral transcription; positive regulation of RNA export from nucleus; RNA splicing; histone mRNA metabolic process; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; mRNA capping; RNA elongation from RNA polymerase II promoter; mRNA catabolic process, nonsense-mediated decay; snRNA export from nucleus; gene expression; RNA-mediated gene silencing; nuclear mRNA cis splicing, via U2-type spliceosome; mRNA 3'-end processing; termination of RNA polymerase II transcription; regulation of translational initiation

Research Articles on NCBP2

Similar Products

Product Notes

The NCBP2 ncbp2 (Catalog #AAA6148407) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCBP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCBP2 ncbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCBP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.