Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Mouse anti-Human NAP1L1 Monoclonal Antibody | anti-NAP1L1 antibody
NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (Biotin)
Gene Names
NAP1L1; NRP; NAP1; NAP1L
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAP1L1; Monoclonal Antibody; NAP1L1 (Nucleosome Assembly Protein 1-like 1; NAP-1-related Protein; hNRP; NRP) (Biotin); anti-NAP1L1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A9
Specificity
Recognizes human NAP1L1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NAP1L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human NAP1L1 (NP_004528) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Western Blot (WB)
(NAP1L1 monoclonal antibody Western Blot analysis of NAP1L1 expression in HeLa.)
Western Blot (WB)
(NAP1L1 monoclonal antibody Western Blot analysis of NAP1L1 expression in HeLa.)
Related Product Information for anti-NAP1L1 antibody
NAP1L1 is a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation.
Product Categories/Family for anti-NAP1L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47.2 kDa (408aa), confirmed by MALDI-TOF
NCBI Official Full Name
nucleosome assembly protein 1-like 1 isoform 1
NCBI Official Synonym Full Names
nucleosome assembly protein 1 like 1
NCBI Official Symbol
NAP1L1
NCBI Official Synonym Symbols
NRP; NAP1; NAP1L
NCBI Protein Information
nucleosome assembly protein 1-like 1
UniProt Protein Name
Nucleosome assembly protein 1-like 1
Protein Family
UniProt Gene Name
NAP1L1
UniProt Synonym Gene Names
NRP; hNRP
UniProt Entry Name
NP1L1_HUMAN
NCBI Description
This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015]
Uniprot Description
NAP1L1: May be involved in modulating chromatin formation and contribute to regulation of cell proliferation. Belongs to the nucleosome assembly protein (NAP) family.
Protein type: DNA replication
Chromosomal Location of Human Ortholog: 12q21.2
Cellular Component: membrane; melanosome; nucleus
Molecular Function: protein binding
Biological Process: nucleosome assembly; positive regulation of cell proliferation; DNA replication
Research Articles on NAP1L1
Similar Products
Product Notes
The NAP1L1 nap1l1 (Catalog #AAA6143089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAP1L1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAP1L1 nap1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAP1L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
