Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NAP1L1 polyclonal antibody. Western Blot analysis of NAP1L1 expression in HeLa.)

Mouse anti-Human NAP1L1 Polyclonal Antibody | anti-NAP1L1 antibody

NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP)

Gene Names
NAP1L1; NRP; NAP1; NAP1L
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NAP1L1; Polyclonal Antibody; NAP1L1 (Nucleosome Assembly Protein 1-like 1; NAP-1-related Protein; hNRP; NRP); Anti -NAP1L1 (Nucleosome Assembly Protein 1-like 1; anti-NAP1L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NAP1L1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Applicable Applications for anti-NAP1L1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NAP1L1, aa1-391 (NP_004528.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NAP1L1 polyclonal antibody. Western Blot analysis of NAP1L1 expression in HeLa.)

Western Blot (WB) (NAP1L1 polyclonal antibody. Western Blot analysis of NAP1L1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NAP1L1 expression in transfected 293T cell line by NAP1L1 polyclonal antibody. Lane 1: NAP1L1 transfected lysate (43.01kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NAP1L1 expression in transfected 293T cell line by NAP1L1 polyclonal antibody. Lane 1: NAP1L1 transfected lysate (43.01kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NAP1L1 antibody
NAP1L1 is a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation.
Product Categories/Family for anti-NAP1L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,374 Da
NCBI Official Full Name
nucleosome assembly protein 1-like 1
NCBI Official Synonym Full Names
nucleosome assembly protein 1-like 1
NCBI Official Symbol
NAP1L1
NCBI Official Synonym Symbols
NRP; NAP1; NAP1L
NCBI Protein Information
nucleosome assembly protein 1-like 1; hNRP; NAP-1 related protein; NAP-1-related protein; HSP22-like protein interacting protein
UniProt Protein Name
Nucleosome assembly protein 1-like 1
UniProt Gene Name
NAP1L1
UniProt Synonym Gene Names
NRP; hNRP
UniProt Entry Name
NP1L1_HUMAN

NCBI Description

This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing of this gene results in several transcript variants; however, not all have been fully described. [provided by RefSeq, Jul 2008]

Uniprot Description

NAP1L1: May be involved in modulating chromatin formation and contribute to regulation of cell proliferation. Belongs to the nucleosome assembly protein (NAP) family.

Protein type: DNA replication

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: membrane; melanosome; nucleus

Molecular Function: protein binding

Biological Process: nucleosome assembly; positive regulation of cell proliferation; DNA replication

Research Articles on NAP1L1

Similar Products

Product Notes

The NAP1L1 nap1l1 (Catalog #AAA6001763) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAP1L1 (Nucleosome Assembly Protein 1-like 1, NAP-1-related Protein, hNRP, NRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAP1L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NAP1L1 nap1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADIDNKEQS ELDQDLDDVE EVEEEETGEE TKLKARQLTV QMMQNPQILA ALQERLDGLV ETPTGYIESL PRVVKRRVNA LKNLQVKCAQ IEAKFYEEVH DLERKYAVLY QPLFDKRFEI INAIYEPTEE ECEWKPDEED EISEELKEKA KIEDEKKDEE KEDPKGIPEF WLTVFKNVDL LSDMVQEHDE PILKHLKDIK VKFSDAGQPM SFVLEFHFEP NEYFTNEVLT KTYRMRSEPD DSDPFSFDGP EIMGCTGCQI DWKKGKNVTL KTIKKKQKHK GRGTVRTVTK TVSNDSFFNF FAPPEVPESG DLDDDAEAIL AADFEIGHFL RERIIPRSVL YFTGEAIEDD DDDYDEEGEE ADEEGEEEGD EENDPDYDPK KDQNPAECKQ Q. It is sometimes possible for the material contained within the vial of "NAP1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.