Mouse anti-Human MYL5 Monoclonal Antibody | anti-MFSD7 antibody

MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2)

Cat. Num. AAA6006862

• Gene Names: MFSD7; LP2561
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MYL5; Monoclonal Antibody; MYL5 (Myosin Light Chain 5; Myosin Regulatory Light Chain 5; Superfast Myosin Regulatory Light Chain 2; MYLC2; MyLC-2); Anti -MYL5 (Myosin Light Chain 5; anti-MFSD7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C5
• Specificity: Recognizes human MYL5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE

• Applicable Applications for anti-MFSD7 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-132 from human MYL5 (AAH40050) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.26kD).)

Western Blot (WB)

(Western Blot analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody.|Lane 1: MYL5 transfected lysate (19.5kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MYL5 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MFSD7 antibody

Myosin regulatory light chain 5, also known as MYL5, is a hexameric ATPase cellular motor protein. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL5 is a regulatory light chain and is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. Reconstitution of myosin with regulatory light chain 5 or alkali light chain increases filament velocity to intermediate rates, and readdition of both classes of light chains fully restores the original sliding velocity.

Product Categories/Family for anti-MFSD7 antibody

Antibodies; Abs to Cardiac Markers

NCBI and Uniprot Product Information

• NCBI GI #: 31542731
• NCBI GeneID: 84179
• NCBI Accession #: NP_115595.2
• NCBI GenBank Nucleotide #: NM_032219.2
• UniProt Accession #: Q6UXD7; Q6XYD4; Q8N6H1; Q9H6H6; A8K7J5
• Molecular Weight: 58,427 Da
• NCBI Official Full Name: major facilitator superfamily domain-containing protein 7
• NCBI Official Synonym Full Names: major facilitator superfamily domain containing 7
• NCBI Official Symbol: MFSD7
• NCBI Official Synonym Symbols: LP2561
• NCBI Protein Information: major facilitator superfamily domain-containing protein 7; MYL5; myosin light polypeptide 5 regulatory protein
• UniProt Protein Name: Major facilitator superfamily domain-containing protein 7
• Protein Family: Major facilitator superfamily domain-containing protein
• UniProt Gene Name: MFSD7
• UniProt Synonym Gene Names: MYL5
• UniProt Entry Name: MFSD7_HUMAN

Uniprot Description

MFSD7: Belongs to the major facilitator superfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: integral to membrane

Biological Process: transmembrane transport