Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (40.26kD).)

Mouse anti-Human MYL5 Monoclonal Antibody | anti-MYL5 antibody

MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2) (FITC)

Gene Names
MYL5; MYLC2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYL5; Monoclonal Antibody; MYL5 (Myosin Light Chain 5; Myosin Regulatory Light Chain 5; Superfast Myosin Regulatory Light Chain 2; MYLC2; MyLC-2) (FITC); anti-MYL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C5
Specificity
Recognizes human MYL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
812
Applicable Applications for anti-MYL5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-132 from human MYL5 (AAH40050) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.26kD).)

Western Blot (WB) (Western Blot detection against Immunogen (40.26kD).)

Western Blot (WB)

(Western Blot analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody. Lane 1: MYL5 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MYL5 expression in transfected 293T cell line by MYL5 monoclonal antibody. Lane 1: MYL5 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MYL5 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYL5 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-MYL5 antibody
Myosin regulatory light chain 5, also known as MYL5, is a hexameric ATPase cellular motor protein. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL5 is a regulatory light chain and is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. Reconstitution of myosin with regulatory light chain 5 or alkali light chain increases filament velocity to intermediate rates, and readdition of both classes of light chains fully restores the original sliding velocity.
Product Categories/Family for anti-MYL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens myosin, light chain 5, regulatory, mRNA
NCBI Official Synonym Full Names
myosin light chain 5
NCBI Official Symbol
MYL5
NCBI Official Synonym Symbols
MYLC2
NCBI Protein Information
myosin light chain 5
Protein Family

NCBI Description

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq, Jul 2008]

Research Articles on MYL5

Similar Products

Product Notes

The MYL5 (Catalog #AAA6148358) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYL5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.