Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human MTR Monoclonal Antibody | anti-MTR antibody

MTR (5-Methyltetrahydrofolate-homocysteine Methyltransferase, MTRR, FLJ33168, FLJ43216, FLJ45386) (PE)

Gene Names
MTRR; MSR; cblE
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTR; Monoclonal Antibody; MTR (5-Methyltetrahydrofolate-homocysteine Methyltransferase; MTRR; FLJ33168; FLJ43216; FLJ45386) (PE); anti-MTR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Specificity
Recognizes human MTRR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
698
Applicable Applications for anti-MTR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human MTRR (NP_002445) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)
Related Product Information for anti-MTR antibody
MTR catalyses the re-methylation of homocysteine to form methionine. Mutations of MTR have been identified as an underlying cause of methylcobalamin deficiency complementation group G.
Product Categories/Family for anti-MTR antibody
References
1. Diflavin Oxidoreductases Activate the Bioreductive Prodrug PR-104A under Hypoxia. Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV.Mol Pharmacol. 2012 Jan;81(1):31-40. Epub 2011 Oct 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
methionine synthase reductase
NCBI Official Synonym Full Names
5-methyltetrahydrofolate-homocysteine methyltransferase reductase
NCBI Official Symbol
MTRR
NCBI Official Synonym Symbols
MSR; cblE
NCBI Protein Information
methionine synthase reductase
UniProt Protein Name
Methionine synthase reductase
Protein Family
UniProt Gene Name
MTRR
UniProt Synonym Gene Names
MSR
UniProt Entry Name
MTRR_HUMAN

NCBI Description

This gene encodes a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. This protein functions in the synthesis of methionine by regenerating methionine synthase to a functional state. Because methionine synthesis requires methyl-group transfer by a folate donor, activity of the encoded enzyme is important for folate metabolism and cellular methylation. Mutations in this gene can cause homocystinuria-megaloblastic anemia, cbl E type. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Research Articles on MTR

Similar Products

Product Notes

The MTR mtrr (Catalog #AAA6158937) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTR (5-Methyltetrahydrofolate-homocysteine Methyltransferase, MTRR, FLJ33168, FLJ43216, FLJ45386) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTR mtrr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.