Mouse NBL1 Monoclonal Antibody | anti-NBL1 antibody

NBL1 (Neuroblastoma, Suppression of Tumorigenicity 1, D1S1733E, DAN, DAND1, MGC8972, NB, NO3) (AP)

Cat. Num. AAA6165196

• Gene Names: NBL1; NB; DAN; NO3; DAND1; D1S1733E
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NBL1; Monoclonal Antibody; NBL1 (Neuroblastoma; Suppression of Tumorigenicity 1; D1S1733E; DAN; DAND1; MGC8972; NB; NO3) (AP); Neuroblastoma; NO3; anti-NBL1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G5
• Specificity: Recognizes NBL1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-NBL1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NBL1 (NP_005371, 21aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NBL1 expression in transfected 293T cell line by NBL1 monoclonal antibody (M02), clone 1G5.Lane 1: NBL1 transfected lysate(19.3 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-NBL1 antibody

This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-NBL1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 323276673
• NCBI GeneID: 4681
• NCBI Accession #: NP_005371
• NCBI GenBank Nucleotide #: NM_005380.7
• UniProt Accession #: P41271; Q5TGZ2; Q5U0N4; Q96L68; A3KFI7
• NCBI Official Full Name: neuroblastoma suppressor of tumorigenicity 1 isoform 2
• NCBI Official Synonym Full Names: neuroblastoma 1, DAN family BMP antagonist
• NCBI Official Symbol: NBL1
• NCBI Official Synonym Symbols: NB; DAN; NO3; DAND1; D1S1733E
• NCBI Protein Information: neuroblastoma suppressor of tumorigenicity 1
• UniProt Protein Name: Neuroblastoma suppressor of tumorigenicity 1
• Protein Family: N-terminal-borealin-like protein
• UniProt Gene Name: NBL1
• UniProt Synonym Gene Names: DAN; DAND1
• UniProt Entry Name: NBL1_HUMAN

NCBI Description

This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. [provided by RefSeq, May 2013]

Uniprot Description

NBL1 iso2: Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process. Belongs to the DAN family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Tumor suppressor; Secreted

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: extracellular space

Molecular Function: morphogen activity; protein homodimerization activity

Biological Process: nervous system development; determination of dorsal identity; positive regulation of neuron differentiation; neurite morphogenesis; negative regulation of BMP signaling pathway