Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody.)

Mouse MST1R Monoclonal Antibody | anti-MST1R antibody

MST1R (macrophage Stimulating 1 Receptor (c-met-Related Tyrosine Kinase), CD136, CDw136, PTK8, RON) (Biotin)

Gene Names
MST1R; RON; SEA; PTK8; CD136; NPCA3; CDw136
Applications
ELISA
Purity
Purified
Synonyms
MST1R; Monoclonal Antibody; MST1R (macrophage Stimulating 1 Receptor (c-met-Related Tyrosine Kinase); CD136; CDw136; PTK8; RON) (Biotin); macrophage Stimulating 1 Receptor (c-met-Related Tyrosine Kinase); RON; anti-MST1R antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F3
Specificity
Recognizes MST1R.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1400
Applicable Applications for anti-MST1R antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MST1R (NP_002438, 26aa-125aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-MST1R antibody
Mouse monoclonal antibody raised against a partial recombinant MST1R.
Product Categories/Family for anti-MST1R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
macrophage-stimulating protein receptor isoform 1 preproprotein
NCBI Official Synonym Full Names
macrophage stimulating 1 receptor
NCBI Official Symbol
MST1R
NCBI Official Synonym Symbols
RON; SEA; PTK8; CD136; NPCA3; CDw136
NCBI Protein Information
macrophage-stimulating protein receptor
UniProt Protein Name
Macrophage-stimulating protein receptor
UniProt Gene Name
MST1R
UniProt Synonym Gene Names
PTK8; RON; MSP receptor
UniProt Entry Name
RON_HUMAN

NCBI Description

This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]

Uniprot Description

Ron: a receptor tyrosine kinase of the Met family. Receptor for macrophage stimulating protein. Can be desensitized by c-Cbl and its binding partner Grb2. Overexpression of wild-type RON causes the formation of lung tumors. Two alternatively spliced isoforms have been described.

Protein type: Protein kinase, TK; EC 2.7.10.1; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); TK group; Met family

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cell surface; integral to plasma membrane; stress fiber

Molecular Function: macrophage colony stimulating factor receptor activity; protein binding; enzyme binding; ATP binding

Biological Process: positive regulation of MAP kinase activity; positive regulation of protein kinase B signaling cascade; peptidyl-tyrosine phosphorylation; multicellular organismal development; response to virus; single fertilization; positive regulation of cell proliferation; innate immune response; defense response; signal transduction; cell motility; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on MST1R

Similar Products

Product Notes

The MST1R mst1r (Catalog #AAA6171097) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MST1R can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MST1R mst1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MST1R, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.