Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCT6ASample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CCT6A Polyclonal Antibody | anti-CCT6A antibody

CCT6A Antibody - middle region

Gene Names
CCT6A; CCT6; Cctz; HTR3; TCPZ; TCP20; MoDP-2; TTCP20; CCT-zeta; CCT-zeta-1; TCP-1-zeta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCT6A; Polyclonal Antibody; CCT6A Antibody - middle region; anti-CCT6A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITE
Sequence Length
531
Applicable Applications for anti-CCT6A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human CCT6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCT6ASample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCT6ASample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCT6A antibody
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located.
Product Categories/Family for anti-CCT6A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
908
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
T-complex protein 1 subunit zeta isoform b
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 6A
NCBI Official Symbol
CCT6A
NCBI Official Synonym Symbols
CCT6; Cctz; HTR3; TCPZ; TCP20; MoDP-2; TTCP20; CCT-zeta; CCT-zeta-1; TCP-1-zeta
NCBI Protein Information
T-complex protein 1 subunit zeta
UniProt Protein Name
T-complex protein 1 subunit zeta
Protein Family
UniProt Gene Name
CCT6A
UniProt Synonym Gene Names
CCT6; CCTZ; TCP-1-zeta
UniProt Entry Name
TCPZ_HUMAN

NCBI Description

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, several pseudogenes of this gene have been located. [provided by RefSeq, Jun 2010]

Uniprot Description

CCT-zeta: Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin. Belongs to the TCP-1 chaperonin family.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 7p11.2

Cellular Component: chaperonin-containing T-complex; microtubule; cytoplasm; acrosome; cytosol

Molecular Function: protein binding; unfolded protein binding; ATP binding

Biological Process: 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding; binding of sperm to zona pellucida

Research Articles on CCT6A

Similar Products

Product Notes

The CCT6A cct6a (Catalog #AAA3222768) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT6A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCT6A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCT6A cct6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTASLIAKVA TAQDDITGDG TTSNVLIIGE LLKQADLYIS EGLHPRIITE. It is sometimes possible for the material contained within the vial of "CCT6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.