Mouse anti-Human TRAM2 Monoclonal Antibody | anti-TRAM2 antibody

TRAM2 (Translocating Chain-associated Membrane Protein 2, KIAA0057) (PE)

Cat. Num. AAA6160811

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRAM2; Monoclonal Antibody; TRAM2 (Translocating Chain-associated Membrane Protein 2; KIAA0057) (PE); anti-TRAM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G6
• Specificity: Recognizes human TRAM2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 7047

• Applicable Applications for anti-TRAM2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa310-369 from TRAM2 (NP_036420) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKS
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.34kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TRAM2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TRAM2 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TRAM2 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519246245
• NCBI GeneID: 9697
• NCBI Accession #: NM_012288.4
• NCBI GenBank Nucleotide #: NM_012288
• UniProt Accession #: Q15035
• NCBI Official Full Name: Homo sapiens translocation associated membrane protein 2 (TRAM2), mRNA
• NCBI Official Synonym Full Names: translocation associated membrane protein 2
• NCBI Official Symbol: TRAM2
• NCBI Protein Information: translocating chain-associated membrane protein 2
• UniProt Protein Name: Translocating chain-associated membrane protein 2
• Protein Family: Translocating chain-associated membrane protein
• UniProt Gene Name: TRAM2
• UniProt Synonym Gene Names: KIAA0057

NCBI Description

TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.[supplied by OMIM, Jul 2004]

Uniprot Description

Necessary for collagen type I synthesis. May couple the activity of the ER Ca2+ pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca2+ concentration at the site of collagen synthesis, and a high Ca2+ concentration may be necessary for the function of molecular chaperones involved in collagen folding. Required for proper insertion of the first transmembrane helix N-terminus of TM4SF20 into the ER lumen, may act as a ceramide sensor for regulated alternative translocation (RAT) (PubMed:27499293).