Mouse anti-Human MSMB Monoclonal Antibody | anti-MSMB antibody

MSMB (Beta-microseminoprotein, PSP-94, Immunoglobulin-binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein of 94 Amino Acids, PSP94, Seminal Plasma beta-inhibin, PRSP) (MaxLight 750)

Cat. Num. AAA6233965

• Gene Names: MSMB; MSP; PSP; IGBF; MSPB; PN44; PRPS; HPC13; PSP57; PSP94; PSP-94
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MSMB; Monoclonal Antibody; MSMB (Beta-microseminoprotein; PSP-94; Immunoglobulin-binding Factor; IGBF; PN44; Prostate Secreted Seminal Plasma Protein; Prostate Secretory Protein of 94 Amino Acids; PSP94; Seminal Plasma beta-inhibin; PRSP) (MaxLight 750); anti-MSMB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B11
• Specificity: Recognizes human MSMB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-MSMB antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-114 from human MSMB (AAH05257.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-MSMB antibody

Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.

Product Categories/Family for anti-MSMB antibody

Antibodies; Binding Proteins

References

1. Novel Prognostic Markers in the Serum of Patients With Castration-Resistant Prostate Cancer Derived From Quantitative Analysis of the Pten Conditional Knockout Mouse Proteome. Kalin M, Cima I, Schiess R, Fankhauser N, Powles T, Wild P, Templeton A, Cerny T, Aebersold R, Krek W, Gillessen S.Eur Urol. 2011 Jun 29.

NCBI and Uniprot Product Information

• NCBI GI #: 13528929
• NCBI GeneID: 4477
• Molecular Weight: 8,778 Da
• NCBI Official Full Name: Homo sapiens microseminoprotein, beta-, mRNA
• NCBI Official Synonym Full Names: microseminoprotein beta
• NCBI Official Symbol: MSMB
• NCBI Official Synonym Symbols: MSP; PSP; IGBF; MSPB; PN44; PRPS; HPC13; PSP57; PSP94; PSP-94
• NCBI Protein Information: beta-microseminoprotein
• Protein Family: Methanesulfonate monooxygenase hydroxylase

NCBI Description

The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]