Mouse anti-Human MMP26 Monoclonal Antibody | anti-MMP26 antibody

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592) (FITC)

Cat. Num. AAA6148253

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP26; Monoclonal Antibody; MMP26 (Matrix Metalloproteinase-26; MMP-26; Matrilysin-2; Endometase; MGC126590; MGC126592) (FITC); anti-MMP26 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6C6
• Specificity: Recognizes human MMP26.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-MMP26 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa152-262 from human MMP26 (NP_068573) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(MMP26 monoclonal antibody. Western Blot analysis of MMP26 expression in HeLa.)

Western Blot (WB)

(MMP26 monoclonal antibody. Western Blot analysis of MMP26 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged MMP26 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-MMP26 antibody

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP26 may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. It is also able to activates progelatinase B. MMP26 is expressed specifically in uterus and placenta. Is also widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines.

Product Categories/Family for anti-MMP26 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 73808266
• NCBI GeneID: 56547
• NCBI Accession #: NP_068573
• NCBI GenBank Nucleotide #: NM_021801
• UniProt Accession #: Q9NRE1
• Molecular Weight: 19kDa
• NCBI Official Full Name: matrix metalloproteinase-26 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 26
• NCBI Official Symbol: MMP26
• NCBI Protein Information: matrix metalloproteinase-26
• UniProt Protein Name: Matrix metalloproteinase-26
• Protein Family: Matrix metalloproteinase
• UniProt Gene Name: MMP26
• UniProt Synonym Gene Names: MMP-26

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme may degrade collagen type IV, fibronectin, fibrinogen, and beta-casein, and activate matrix metalloproteinase-9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The encoded protein may promote cell invasion in multiple human cancers. [provided by RefSeq, May 2016]

Uniprot Description

May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B.