Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human MRC1 Monoclonal Antibody | anti-MRC1 antibody

MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) APC

Gene Names
MRC1; MMR; hMR; CD206; MRC1L1; CLEC13D; CLEC13DL; bA541I19.1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MRC1; Monoclonal Antibody; MRC1 (Macrophage Mannose Receptor 1; MMR; C-type Lectin Domain Family 13 Member D; C-type Lectin Domain Family 13 Member D-like; Macrophage Mannose Receptor 1-like Protein 1; CD206; CLEC13D; CLEC13DL; MRC1L1) APC; anti-MRC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C11
Specificity
Recognizes human MRC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1456
Applicable Applications for anti-MRC1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-130 from human MRC1 (NP_002429) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(MRC1 monoclonal antibody. Western Blot analysis of MRC1 expression in human pancreas.)

Western Blot (WB) (MRC1 monoclonal antibody. Western Blot analysis of MRC1 expression in human pancreas.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MRC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MRC1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MRC1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-MRC1 antibody
References
1. Xanthogranulomatous cholecystitis: A clinicopathological study of its association with gallbladder carcinoma. Zhuang PY, Zhu MJ, Wang JD, Zhou XP, Quan ZW, Shen J.J Dig Dis. 2012 Sep 21. doi: 10.1111/j.1751-2980.2012.00645.x. 2. Coronary Atherosclerosis Is Associated With Macrophage Polarization in Epicardial Adipose Tissue. Hirata Y, Tabata M, Kurobe H, Motoki T, Akaike M, Nishio C, Higashida M, Mikasa H, Nakaya Y, Takanashi S, Igarashi T, Kitagawa T, Sata M.J Am Coll Cardiol. 2011 Jul 12;58(3):248-55.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
macrophage mannose receptor 1
NCBI Official Synonym Full Names
mannose receptor C-type 1
NCBI Official Symbol
MRC1
NCBI Official Synonym Symbols
MMR; hMR; CD206; MRC1L1; CLEC13D; CLEC13DL; bA541I19.1
NCBI Protein Information
macrophage mannose receptor 1
UniProt Protein Name
Macrophage mannose receptor 1
UniProt Gene Name
MRC1
UniProt Synonym Gene Names
CLEC13D; CLEC13DL; MRC1L1; MMR
UniProt Entry Name
MRC1_HUMAN

NCBI Description

The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment.[provided by RefSeq, Sep 2015]

Uniprot Description

MRC1: Mediates the endocytosis of glycoproteins by macrophages. Binds both sulfated and non-sulfated polysaccharide chains. Acts as phagocytic receptor for bacteria, fungi and other pathogens. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10p12.33

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; endosome membrane

Molecular Function: mannose binding; protein binding; transmembrane receptor activity; receptor activity

Biological Process: receptor-mediated endocytosis; signal transduction

Research Articles on MRC1

Similar Products

Product Notes

The MRC1 mrc1 (Catalog #AAA6137674) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MRC1 mrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MRC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.