Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Mouse anti-Human ELF4 Monoclonal Antibody | anti-ELF4 antibody

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (Biotin)

Gene Names
ELF4; MEF; ELFR
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ELF4; Monoclonal Antibody; ELF4 (ETS-related Transcription Factor Elf-4; E74-like Factor 4; Myeloid Elf-1-like Factor; MEF; ELFR) (Biotin); anti-ELF4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
1E10
Specificity
Recognizes human ELF4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ELF4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa521-612 from human ELF4 (NP_001412) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.86kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)
Related Product Information for anti-ELF4 antibody
ELF4 is transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. The protein acts synergistically with RUNX1 to transactivate the IL3 promoter. Also transactivates the PRF1 promoter in natural killer (NK) cells. This protein plays a role in the development and function of NK and NK T-cells and in innate immunity.
Product Categories/Family for anti-ELF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
ETS-related transcription factor Elf-4
NCBI Official Synonym Full Names
E74 like ETS transcription factor 4
NCBI Official Symbol
ELF4
NCBI Official Synonym Symbols
MEF; ELFR
NCBI Protein Information
ETS-related transcription factor Elf-4
UniProt Protein Name
ETS-related transcription factor Elf-4
UniProt Gene Name
ELF4
UniProt Synonym Gene Names
ELFR; MEF
UniProt Entry Name
ELF4_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010]

Uniprot Description

ELF4: Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter. Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T-cells via the Kruppel-like factors KLF4 and KLF2. Controls cell senescence in a p53-dependent manner. Can also promote cellular transformation through inhibition of the p16 pathway. A chromosomal aberration involving ELF4 has been found in a case of acute myeloid leukemia (AML). Translocation t(X;21)(q25-26;q22) with ERG. Belongs to the ETS family.

Protein type: Oncoprotein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: Xq26

Cellular Component: nucleoplasm; PML body

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; natural killer cell proliferation; NK T cell proliferation; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on ELF4

Similar Products

Product Notes

The ELF4 elf4 (Catalog #AAA6141712) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELF4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELF4 elf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELF4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.