Mouse anti-Human MKRN2 Monoclonal Antibody

MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070)

Cat. Num. AAA644182

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MKRN2; Monoclonal Antibody; MKRN2 (RNF62; Probable E3 Ubiquitin-protein Ligase Makorin-2; RING Finger Protein 62; HSPC070); Anti -MKRN2 (RNF62; anti-MKRN2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5F8
• Specificity: Recognizes human MKRN2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: AFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSE*

• Applicable Applications for anti-MKRN2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa317-416 from MKRN2 (NP_054879) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 monoclonal antibody.|Lane 1: MKRN2 transfected lysate (46.9kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MKRN2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MKRN2 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MKRN2 over-expressed 293 cell line, cotransfected with MKRN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MKRN2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(MKRN2 monoclonal antibody Western Blot analysis of MKRN2 expression in Hela NE.)

Related Product Information for anti-MKRN2 antibody

The basic function of MKRN2 is mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination. Makorin RING zinc finger-2 (MKRN2), overlaps and is antisense to the gene RAF1 in mammals. Northern blot analyses show that human MKRN2 and RAF1 are co-expressed in tissues and cell lines, raising the possibility of mRNA duplex formation. The encoded makorin-2 protein is likely a ribonucleoprotein of unknown function, but its conservation suggests an important cellular role.

Product Categories/Family for anti-MKRN2 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger