Mouse anti-Human MKRN2 Monoclonal Antibody | anti-MKRN2 antibody

MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070) (Biotin)

Cat. Num. AAA6142936

• Gene Names: MKRN2; RNF62; HSPC070
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MKRN2; Monoclonal Antibody; MKRN2 (RNF62; Probable E3 Ubiquitin-protein Ligase Makorin-2; RING Finger Protein 62; HSPC070) (Biotin); anti-MKRN2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5F8
• Specificity: Recognizes human MKRN2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2775

• Applicable Applications for anti-MKRN2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa317-416 from MKRN2 (NP_054879) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSE*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 monoclonal antibody. Lane 1: MKRN2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MKRN2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MKRN2 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MKRN2 over-expressed 293 cell line, cotransfected with MKRN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MKRN2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(MKRN2 monoclonal antibody Western Blot analysis of MKRN2 expression in Hela NE.)

Product Categories/Family for anti-MKRN2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 1519312601
• NCBI GeneID: 23609
• NCBI Accession #: NM_014160.5
• NCBI GenBank Nucleotide #: NM_014160
• UniProt Accession #: Q9H000
• NCBI Official Full Name: Homo sapiens makorin ring finger protein 2 (MKRN2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: makorin ring finger protein 2
• NCBI Official Symbol: MKRN2
• NCBI Official Synonym Symbols: RNF62; HSPC070
• NCBI Protein Information: probable E3 ubiquitin-protein ligase makorin-2
• UniProt Protein Name: Probable E3 ubiquitin-protein ligase makorin-2
• Protein Family: MKRN2 opposite strand protein
• UniProt Gene Name: MKRN2
• UniProt Synonym Gene Names: RNF62
• UniProt Entry Name: MKRN2_HUMAN

NCBI Description

This gene encodes a probable E3 ubiquitin ligase containing several zinc finger domains, that is a member of the makorin RING zinc-finger protein family. This gene overlaps the v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1) gene in an antisense orientation and may have a co-regulatory function with RAF1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]