Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 polyclonal antibody. Lane 1: MKRN2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MKRN2 Polyclonal Antibody | anti-MKRN2 antibody

MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070)

Gene Names
MKRN2; RNF62; HSPC070
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MKRN2; Polyclonal Antibody; MKRN2 (RNF62; Probable E3 Ubiquitin-protein Ligase Makorin-2; RING Finger Protein 62; HSPC070); Anti -MKRN2 (RNF62; anti-MKRN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MKRN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Applicable Applications for anti-MKRN2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MKRN2, aa1-416 (NP_054879.3).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 polyclonal antibody. Lane 1: MKRN2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 polyclonal antibody. Lane 1: MKRN2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MKRN2 antibody
The basic function of MKRN2 is mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination. Makorin RING zinc finger-2 (MKRN2), overlaps and is antisense to the gene RAF1 in mammals. Northern blot analyses show that human MKRN2 and RAF1 are co-expressed in tissues and cell lines, raising the possibility of mRNA duplex formation. The encoded makorin-2 protein is likely a ribonucleoprotein of unknown function, but its conservation suggests an important cellular role.
Product Categories/Family for anti-MKRN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,940 Da
NCBI Official Full Name
MKRN2 protein
NCBI Official Synonym Full Names
makorin ring finger protein 2
NCBI Official Symbol
MKRN2
NCBI Official Synonym Symbols
RNF62; HSPC070
NCBI Protein Information
probable E3 ubiquitin-protein ligase makorin-2; RING finger protein 62; makorin RING zinc-finger protein 2
UniProt Protein Name
Probable E3 ubiquitin-protein ligase makorin-2
UniProt Gene Name
MKRN2
UniProt Synonym Gene Names
RNF62
UniProt Entry Name
MKRN2_HUMAN

NCBI Description

This gene encodes a probable E3 ubiquitin ligase containing several zinc finger domains, that is a member of the makorin RING zinc-finger protein family. This gene overlaps the v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1) gene in an antisense orientation and may have a co-regulatory function with RAF1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

MKRN2: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.

Protein type: EC 6.3.2.-; Ubiquitin ligase; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p25

Cellular Component: intracellular

Molecular Function: protein binding; zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Research Articles on MKRN2

Similar Products

Product Notes

The MKRN2 mkrn2 (Catalog #AAA6010215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MKRN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MKRN2 mkrn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTKQITCRY FMHGVCREGS QCLFSHDLAN SKPSTICKYY QKGYCAYGTR CRYDHTRPSA AAGGAVGTMA HSVPSPAFHS PHPPSEVTAS IVKTNSHEPG KREKRTLVLR DRNLSGMAER KTQPSMVSNP GSCSDPQPSP EMKPHSYLDA IRSGLDDVEA SSSYSNEQQL CPYAAAGECR FGDACVYLHG EVCEICRLQV LHPFDPEQRK AHEKICMLTF EHEMEKAFAF QASQDKVCSI CMEVILEKAS ASERRFGILS NCNHTYCLSC IRQWRCAKQF ENPIIKSCPE CRVISEFVIP SVYWVEDQNK KNELIEAFKQ GMGKKACKYF EQGKGTCPFG SKCLYRHAYP DGRLAEPEKP RKQLSSQGTV RFFNSVRLWD FIENRESRHV PNNEDVDMTE LGDLFMHLSG VESSEP. It is sometimes possible for the material contained within the vial of "MKRN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.