Rabbit anti-Human MKRN2 Polyclonal Antibody | anti-MKRN2 antibody

MKRN2 (RNF62, Probable E3 Ubiquitin-protein Ligase Makorin-2, RING Finger Protein 62, HSPC070) APC

Cat. Num. AAA6385523

• Gene Names: MKRN2; RNF62; HSPC070
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MKRN2; Polyclonal Antibody; MKRN2 (RNF62; Probable E3 Ubiquitin-protein Ligase Makorin-2; RING Finger Protein 62; HSPC070) APC; anti-MKRN2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MKRN2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2778

• Applicable Applications for anti-MKRN2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MKRN2, aa1-416 (NP_054879.3).
• Immunogen Sequence: MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MKRN2 expression in transfected 293T cell line by MKRN2 polyclonal antibody. Lane 1: MKRN2 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MKRN2 antibody

The basic function of MKRN2 is mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination. Makorin RING zinc finger-2 (MKRN2), overlaps and is antisense to the gene RAF1 in mammals. Northern blot analyses show that human MKRN2 and RAF1 are co-expressed in tissues and cell lines, raising the possibility of mRNA duplex formation. The encoded makorin-2 protein is likely a ribonucleoprotein of unknown function, but its conservation suggests an important cellular role.

Product Categories/Family for anti-MKRN2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 32880198
• NCBI GeneID: 23609
• NCBI Accession #: NM_014160.3
• NCBI GenBank Nucleotide #: NM_014160.3
• UniProt Accession #: Q9H000
• NCBI Official Full Name: Homo sapiens makorin ring finger protein 2 (MKRN2), mRNA
• NCBI Official Synonym Full Names: makorin ring finger protein 2
• NCBI Official Symbol: MKRN2
• NCBI Official Synonym Symbols: RNF62; HSPC070
• NCBI Protein Information: probable E3 ubiquitin-protein ligase makorin-2
• UniProt Protein Name: Probable E3 ubiquitin-protein ligase makorin-2
• Protein Family: MKRN2 opposite strand protein
• UniProt Gene Name: MKRN2
• UniProt Synonym Gene Names: RNF62
• UniProt Entry Name: MKRN2_HUMAN

NCBI Description

This gene encodes a probable E3 ubiquitin ligase containing several zinc finger domains, that is a member of the makorin RING zinc-finger protein family. This gene overlaps the v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1) gene in an antisense orientation and may have a co-regulatory function with RAF1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]