Mouse anti-Human MCPH1 Monoclonal Antibody | anti-MCPH1 antibody

MCPH1 (Microcephalin, FLJ12847, BRIT1, MCT) (Biotin)

Cat. Num. AAA6142865

• Gene Names: MCPH1; MCT; BRIT1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MCPH1; Monoclonal Antibody; MCPH1 (Microcephalin; FLJ12847; BRIT1; MCT) (Biotin); anti-MCPH1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C9
• Specificity: Recognizes human MCPH1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MCPH1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa399-488 from human MCPH1 (NP_078872) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Testing Data

(Detection limit for recombinant GST tagged MCPH1 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-MCPH1 antibody

This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described.

Product Categories/Family for anti-MCPH1 antibody

Antibodies; DNA Replication; Repair

NCBI and Uniprot Product Information

• NCBI GI #: 1519316290
• NCBI GeneID: 79648
• NCBI Accession #: NP_078872
• NCBI GenBank Nucleotide #: NM_024596
• UniProt Accession #: Q8NEM0
• Molecular Weight: 93kDa
• NCBI Official Full Name: microcephalin isoform 1
• NCBI Official Synonym Full Names: microcephalin 1
• NCBI Official Symbol: MCPH1
• NCBI Official Synonym Symbols: MCT; BRIT1
• NCBI Protein Information: microcephalin
• UniProt Protein Name: Microcephalin
• Protein Family: Microcephalin
• UniProt Gene Name: MCPH1
• UniProt Entry Name: MCPH1_HUMAN

NCBI Description

This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]

Uniprot Description

MCPH1: a DNA damage responsive protein and transcriptional repressor of human telomere reverse transcriptase. An early responder to DNA damage. Required for double strand break repair via homologous recombination and nonhomologous end joining. Promotes chromatin relaxation by recruiting and maintaining the chromatin remodeling SWI-SNF complex at sites of DNA double strand breakage. Participates in the ATR/Chk1-mediated DNA checkpoint in humans and transcriptionally regulates BRCA1 and Chk1. Plays a role in neurogenesis and regulation of the size of the cerebral cortex. Mutations of MCPH1 can cause microcephaly in humans and appears to play an evolutionarily conserved role in brain development. Alterations have been identified in breast, ovarian and prostate cancer. Appears to coordinate S-M transitions in fly embryos.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center

Molecular Function: identical protein binding; protein binding

Biological Process: mitotic cell cycle; cerebral cortex development

Disease: Microcephaly 1, Primary, Autosomal Recessive