Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human MCPH1 Monoclonal Antibody | anti-MCPH1 antibody

MCPH1 (Microcephalin, FLJ12847, BRIT1, MCT) APC

Gene Names
MCPH1; MCT; BRIT1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MCPH1; Monoclonal Antibody; MCPH1 (Microcephalin; FLJ12847; BRIT1; MCT) APC; anti-MCPH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C9
Specificity
Recognizes human MCPH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MCPH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa399-488 from human MCPH1 (NP_078872) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Testing Data

(Detection limit for recombinant GST tagged MCPH1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MCPH1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-MCPH1 antibody
This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-MCPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
microcephalin isoform 1
NCBI Official Synonym Full Names
microcephalin 1
NCBI Official Symbol
MCPH1
NCBI Official Synonym Symbols
MCT; BRIT1
NCBI Protein Information
microcephalin
UniProt Protein Name
Microcephalin
Protein Family
UniProt Gene Name
MCPH1
UniProt Entry Name
MCPH1_HUMAN

NCBI Description

This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal recessive microcephaly 1 and premature chromosome condensation syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]

Uniprot Description

MCPH1: a DNA damage responsive protein and transcriptional repressor of human telomere reverse transcriptase. An early responder to DNA damage. Required for double strand break repair via homologous recombination and nonhomologous end joining. Promotes chromatin relaxation by recruiting and maintaining the chromatin remodeling SWI-SNF complex at sites of DNA double strand breakage. Participates in the ATR/Chk1-mediated DNA checkpoint in humans and transcriptionally regulates BRCA1 and Chk1. Plays a role in neurogenesis and regulation of the size of the cerebral cortex. Mutations of MCPH1 can cause microcephaly in humans and appears to play an evolutionarily conserved role in brain development. Alterations have been identified in breast, ovarian and prostate cancer. Appears to coordinate S-M transitions in fly embryos.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center

Molecular Function: identical protein binding; protein binding

Biological Process: mitotic cell cycle; cerebral cortex development

Disease: Microcephaly 1, Primary, Autosomal Recessive

Research Articles on MCPH1

Similar Products

Product Notes

The MCPH1 mcph1 (Catalog #AAA6137562) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCPH1 (Microcephalin, FLJ12847, BRIT1, MCT) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCPH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCPH1 mcph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCPH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.