Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MCM2 monoclonal antibody Western Blot analysis of MCM2 expression in HeLa NE.)

Mouse anti-Human MCM2 Monoclonal Antibody | anti-MCM2 antibody

MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (AP)

Gene Names
MCM2; BM28; CCNL1; CDCL1; cdc19; DFNA70; D3S3194; MITOTIN
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MCM2; Monoclonal Antibody; MCM2 (DNA Replication Licensing Factor MCM2; Minichromosome Maintenance Protein 2 Homolog; Nuclear Protein BM28; BM28; CCNL1; CDCL1; KIAA0030; MGC10606) (AP); anti-MCM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A8
Specificity
Recognizes human MCM2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MCM2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa805-904 from human MCM2 (AAH07670) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MCM2 monoclonal antibody Western Blot analysis of MCM2 expression in HeLa NE.)

Western Blot (WB) (MCM2 monoclonal antibody Western Blot analysis of MCM2 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody. Lane 1: MCM2 transfected lysate (101.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody. Lane 1: MCM2 transfected lysate (101.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of MCM2 transfected lysate using MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MCM2 transfected lysate using MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MCM2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MCM2 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)
Product Categories/Family for anti-MCM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
101,896 Da
NCBI Official Full Name
Homo sapiens minichromosome maintenance complex component 2, mRNA
NCBI Official Synonym Full Names
minichromosome maintenance complex component 2
NCBI Official Symbol
MCM2
NCBI Official Synonym Symbols
BM28; CCNL1; CDCL1; cdc19; DFNA70; D3S3194; MITOTIN
NCBI Protein Information
DNA replication licensing factor MCM2

NCBI Description

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Oct 2012]

Research Articles on MCM2

Similar Products

Product Notes

The MCM2 (Catalog #AAA6132254) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCM2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.