Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human MAPRE2 Monoclonal Antibody | anti-MAPRE2 antibody

MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MAPRE2; Monoclonal Antibody; MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2; APC-binding Protein EB2; End-binding Protein 2; EB2; RP1); Anti -MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2; anti-MAPRE2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D7
Specificity
Recognizes human MAPRE2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
Applicable Applications for anti-MAPRE2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 35ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-63 from human MAPRE2 (NP_055083) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB)

(MAPRE2 monoclonal antibody Western Blot analysis of MAPRE2 expression in K-562.)

Western Blot (WB) (MAPRE2 monoclonal antibody Western Blot analysis of MAPRE2 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody |Lane 1: MAPRE2 transfected lysate (37kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody |Lane 1: MAPRE2 transfected lysate (37kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35ug/ml].)
Related Product Information for anti-MAPRE2 antibody
May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
Product Categories/Family for anti-MAPRE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
37,031 Da
NCBI Official Full Name
MAPRE2
UniProt Protein Name
Microtubule-associated protein RP/EB family member 2
UniProt Gene Name
MAPRE2
UniProt Synonym Gene Names
RP1; EB2
UniProt Entry Name
MARE2_HUMAN

Uniprot Description

Function: May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration

By similarity.

Subunit structure: Interacts with DCTN1. Binds to the C-terminal domain of APC. Binds monomeric and polymerized tubulin. Ref.1 Ref.9 Ref.10

Subcellular location: Cytoplasm › cytoskeleton. Note: Associated with the microtubule network. Accumulates at the plus end of microtubules. Ref.9

Tissue specificity: Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes. Ref.1

Domain: Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.

Sequence similarities: Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain.

Sequence caution: The sequence BAA83375.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The MAPRE2 mapre2 (Catalog #AAA648443) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPRE2 (Microtubule-associated Protein RP/EB Family Member 2, APC-binding Protein EB2, End-binding Protein 2, EB2, RP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPRE2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 35ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the MAPRE2 mapre2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGPTQTLSP NGENNNDIIQ DNNGTIIPFR KHTVRGERSY SWGMAVNVYS TSITQETMSR HD. It is sometimes possible for the material contained within the vial of "MAPRE2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.